NiNa.Az
wkhsinokhwid 19 wkhsinephuxldkartidechuxokhwid 19 phasaxun efadu aekikh epliynthangcak wkhsinorkhtidechuxiwrsokhorna 2019 wkhsinorkhtidechuxiwrsokhorna 2019 epnwkhsinthimungsrangphumikhumkntxechuxiwrsokhornathiepnsaehtukhxngorkhokhwid 19 odykxnthicaekidkarrabadthwkhxngokhwid 19 idmikhwamphyayaminkarphthnawkhsinsahrborkhiwrsokhornachnidthiepnsaehtukhxngorkhxun echn klumxakarthangedinhayicechiybphlnrunaerng sars hrux SARS aelaorkhthangedinhayictawnxxkklang emxrs hrux MERS maxyangtxenuxng khwamphyayamehlaniidsasmkhwamruphxsmkhwrekiywkbokhrngsrangaelakarthangankhxngiwrsokhorna sungidchwyihkarphthnaethkhonolyiwkhsinokhwidtang tngaettnpi 2020 daeninipidxyangrwderw 1 erimtngaetwnthi 10 mkrakhm 2020 sungmikarephyaephrladbyinphanciesd GISAID aela n wnthi 19 minakhm xutsahkrrmyathwolkkidprakaskhamnsyyathicathakarephuxcdkarorkh 2 wkhsinokhwid 19 idekhrditodythwipwachwyldkartidtx khwamrunaerng aelaxtrakartayenuxngkborkh 3 xtraprachakrthiidrbwkhsinxyangnxy 1 odsaelwinpraethstang aephnthiaesdngkarxnumtiihichwkhsinokhwidinpraethstang xnuyatihichthwip kalngihwkhsinepncanwnmak xnuyatihichepnkarchukechin EUA kalngihwkhsinepncanwnmak xnuyatihichepnkarchukechin EUA miaephncaihwkhsinepncanwnmak bthkhwamniichrabbkhristskrach ephraaxangxingkhristskrachaelakhriststwrrs hruxxyangidxyanghnung inkarthdlxngthangkhlinikrayathi 3 wkhsinhlaychnidsamarthpxngknkartidechuxaebbaesdngxakarodymiprasiththiskysungthungrxyla 95 n eduxnkrkdakhm 2021 miwkhsin 20 chnidthiidkhunthaebiynihichinpraethsxyangnxy 1 praethsrwmthngwkhsinxarexnex 2 chnid ifesxraelaomedxrna wkhsiniwrsokhwid 19 echuxtay 9 chnid BBIBP CorV khxngsionfarm wkhsinkhxng Chinese Academy of Medical Sciences sionaewk okhaewksinkhxngphartaiboxethkh CoviVac khxng Chumakov Centre COVIran Barakat khxng Shifa Pharmed Industrial Group Minhai Kangtai KCONVAC A QazVac khxng Research Institute for Biological Safety Problems aela WIBP CorV khxngsionfarm wkhsinthiichiwrsepnewketxr 5 chnid sputnikilthaelasputnikwikhxngsthabnwicykamaeliy aexstraesenka Ad5 nCoV khxngaekhnsioniboxlxciks aelacxhnsnaexndcxhnsn aelawkhsinhnwyyxyoprtin khxngiwrsokhwid 19 canwn 4 chnid Abdala khxng Center for Genetic Engineering and Biotechnology EpiVacCorona khxngsthabnewktxr Soberana 02 khxng Finlay Institute aela ZF2001 khxng Anhui Zhifei Longcom 4 5 miwkhsinaekhndiedt sungidekhasukarwicyephuxichrksaaelw 330 chnid incanwnni 30 chnidkalngthdlxnginrayathi 1 30 chnidinrayathi 1 2 25 chnidinrayathi 3 aela 8 chnidinrayathi 4 4 praethstang miaephnaeckcahnaywkhsinodycdladbkarihtamklumthiesiyngekidphawaaethrksxn echn phusungxayu aelaklumthiesiyngtidaelwaephrorkh echn bukhlakrthangaephthy 6 mipraethsthikalngphicarnachidwkhsinephiyngodsediywinebuxngtnephuxkhyaychidwkhsinaekprachachnihmakthisudcnkwacamiwkhsinphx 7 8 9 10 cnthungwnthi 10 krkdakhm 2021 xngkhkrsatharnsukhrwm knthwolkraynganwa idchidwkhsinokhwid 19 thung 3 420 lanods aelw 11 phuphlitwkhsinidrabucanwnodswkhsinthicasamarthphlitinpi 2021 iwdngni aexstraesenka xxksfxrd 3 000 lanods ifesxr wbr ibxxnethkh 1 300 lanods phuphlitsputnikwi sionfarm sionaewk aelacxhnsnaexndcxhnsnrayla 1 000 lanods omedxrna tngepaphlit 600 lanods aelaaekhnsioniboxlxciks 500 lanods 12 13 aetcnthungeduxnthnwakhm 2020 praethstang kidsngwkhsinlwnghnaekin 10 000 lanods aelw 14 odykhrunghnungepnpraethsrayidsungaemcamiprachakrephiyngrxyla 14 khxngolk 15 ephraakhwamtxngkarwkhsinsungeyiyngniinchwngpi 2020 21 15 prachachnkhxngpraethskalngphthnathicdwamirayidnxyxacimidrbwkhsincakphuphlitehlanicnthungpi 2023 hrux 2024 cungthaihopraekrmokhaewkscaepnxyangyingephuxihsngwkhsinidthwthungknthwolk 14 15 show all collapse dkhkkarkracaywkhsinokhwid 19 aebngtampraethsaeladinaedn n wnthi 1 singhakhm 2564 a 16 praethsaeladinaedn rbwkhsinaelw b prachakr c olk d 2 196 680 113 28 2 cin e 1 637 395 000 xinediy 359 820 313 26 1 shphaphyuorp 262 721 656 59 0 shrth f 190 509 183 57 0 brasil 103 597 287 48 7 eyxrmni 51 241 053 61 2 yipun 48 862 145 38 6 xinodniesiy 46 805 993 17 1 shrachxanackr 46 775 525 68 9 emksiok 45 952 314 35 6 frngess 41 673 008 61 7 turki 40 929 557 48 5 xitali g 38 352 334 63 4 rsesiy 36 287 070 24 9 sepn 31 592 444 67 6 pakisthan e 28 743 225 aekhnada 26 958 920 71 4 xarecntina 24 754 641 54 8 ekahliit 18 729 701 36 5 saxudixaraebiy 18 679 153 53 6 opaelnd 18 285 323 48 3 okhlxmebiy 17 032 633 33 5 chili 13 810 109 72 2 omrxkok 13 537 493 36 7 maelesiy 13 500 479 41 7 ithy 12 307 788 17 6 enethxraelnd 11 855 109 69 2 filippins 11 524 212 10 5 srilngka 9 178 909 42 9 exkwadxr 8 642 055 49 0 xxsetreliy 8 276 192 32 5 ebleyiym 7 993 557 69 0 epru 7 819 321 23 7 shrthxahrbexmierts 7 743 985 78 3 xihran 7 741 936 9 2 ithwn 7 707 830 32 4 bngklaeths 7 428 061 4 5 kmphucha 7 131 184 42 6 oprtueks 6 976 394 68 4 swiedn 6 392 465 63 3 aexfrikait 5 921 627 10 0 xisraexl 5 783 156 66 8 kris 5 690 258 54 6 echkekiy 5 630 714 52 6 hngkari 5 617 260 58 1 satharnrthodminikn 5 524 571 50 9 khaskhsthan 5 321 718 28 3 xxsetriy 5 287 726 58 7 ormaeniy 4 986 820 25 9 ewiydnam 4 983 496 5 1 switesxraelnd 4 654 052 53 8 singkhopr 4 290 278 73 3 ednmark 4 184 199 72 2 xiyipt 3 697 974 3 6 finaelnd 3 687 551 66 5 xusebkisthan 3 667 979 11 0 enpal 3 650 733 12 5 nxrewy 3 565 349 65 8 yuekhrn 3 525 848 8 1 khiwba 3 504 781 30 9 aexlcieriy 3 421 279 7 8 ixraelnd 3 292 726 66 7 hxngkng 3 197 445 42 6 cxraedn 2 954 485 29 0 obliewiy 2 863 296 24 5 esxrebiy 2 833 947 41 6 xaesxribcan 2 827 855 27 9 exlslwadxr 2 821 728 43 5 xurukwy 2 562 662 73 8 khxstarika 2 352 430 46 2 solwaekiy 2 257 621 41 4 exthioxepiy 2 216 338 1 9 mxngokeliy 2 174 672 66 3 katar 2 050 819 71 2 parakwy 1 837 008 25 8 kwetmala 1 701 925 9 5 tuniesiy 1 699 805 14 4 okhrexechiy 1 643 402 40 0 panama 1 637 695 38 0 hxndurs 1 597 377 16 1 simbbew 1 562 285 10 5 oxman 1 550 910 30 4 lithweniy 1 410 934 51 8 eblarus 1 334 540 14 1 yuknda 1 143 763 2 5 elbanxn 1 112 396 16 3 bahern 1 107 217 65 1 law 1 062 365 14 6 niwsiaelnd 1 059 685 22 0 ekhnya 1 055 341 2 0 blaekeriy 1 026 855 14 8 oktdiwwr 959 349 3 6 aexngokla 958 373 2 9 solwieniy 918 719 44 2 kana 865 422 2 8 ltewiy 765 549 40 6 xfkanisthan 763 020 2 0 aexlebeniy 640 047 22 2 esenkl 640 013 3 8 exsoteniy 637 028 48 0 mxriechiys 634 013 49 9 sudan 627 833 1 4 paelsitn 587 393 11 5 liebiy 546 745 8 0 mxlodwa 546 407 13 6 isprs 530 879 59 8 kini 516 973 3 9 nxrthmasiodeniy 500 995 24 1 phutan 486 242 63 0 thacikisthan 462 542 4 8 khirkissthan 445 911 6 8 fici 441 171 49 2 rwnda 423 182 3 3 malawi 410 724 2 1 mxlta 399 261 90 4 lkesmebirk 392 467 62 7 triniaeddaelaotebok 382 149 27 3 bxseniyaelaehxresokwina 381 381 11 6 omsmbik 372 085 1 2 mldifs 321 523 59 5 cxreciy 311 747 7 8 otok 304 278 3 7 eyemn 298 161 1 0 aesmebiy 284 110 1 6 maeka 283 293 43 6 aekhemxrun 279 987 1 1 timxr elset 276 510 21 0 ixsaelnd 269 095 78 9 khxsxwx 263 847 13 7 nikarakw 252 766 3 8 kayxana 248 970 31 6 bxtswana 209 890 8 9 surinam 186 297 31 8 xiekhwthxeriylkini 178 913 12 8 caemka 178 728 6 0 mxrieteniy 178 483 3 8 mxnetenokr 174 571 27 8 namiebiy 156 942 6 2 kabuewrdi 141 276 25 4 satharnrthkhxngok 132 671 2 4 eblis 126 693 31 9 bruin 126 050 28 8 nxrethirnisprs 108 923 28 5 xarmieniy 108 674 3 7 barebods 99 278 34 5 ekirnsiy e 92 775 kuxraesa 92 447 56 3 satharnrthaexfrikaklang 85 381 1 8 khxomors 84 740 9 7 efrnchphxliniechiy 83 210 29 6 satharnrthprachathipitykhxngok 78 871 0 1 papwniwkini 78 399 0 9 ecxrsiy 73 964 73 2 esechls 72 882 74 1 xaruba 72 787 68 2 niwaekhliodeniy 66 159 23 2 ixlxxfaemn 64 872 76 3 bahamas 60 578 15 4 samw 60 044 30 3 kabxng 52 830 2 4 esathsudan 52 226 0 5 hmuekaaekhyaemn 49 960 76 0 xndxrra 48 445 62 7 ebnin 43 377 0 4 ebxrmiwda 41 873 67 2 yibrxltar 39 329 116 7 exswatini 38 326 3 3 aexntikaaelabarbuda 38 067 38 9 elosoth 36 637 1 7 krinaelnd 36 324 64 0 hmuekaaosolmxn 35 167 5 1 burkinafaos 34 749 0 2 hmuekaaaefor 34 657 70 9 etirkemnisthan 32 240 0 5 esntluechiy 32 237 17 6 esatuemaelaprinsipi 32 090 14 6 aekmebiy 31 254 1 3 txngnga 28 753 27 2 hmuekaaetiksaelaekhkhxs 24 567 63 5 kini bisesa 24 000 1 2 sintmaretin 23 885 55 7 wanuxatu 23 881 7 8 esntkhitsaelaenwis 23 755 44 7 sanmarion 22 908 67 5 chad 22 445 0 1 omnaok 21 796 55 5 ekrenda 21 014 18 7 dxminika 20 851 29 0 liketnsitn 20 632 54 1 esntwinesntaelaekrnadins 15 711 14 2 hmuekaabritichewxrcin 15 620 51 7 hmuekaakhuk 10 931 62 2 aexngkwilla 9 398 62 6 naxuru 7 533 69 5 aekhribebiynenethxraelnd 5 726 21 8 tuwalu 4 772 40 5 walisaelafutuna 4 629 41 2 ehti 4 526 0 0 esntehelna 4 361 71 8 hmuekaafxlkaelnd 2 632 75 6 mxntesxrrt 1 439 28 8 niwew 1 184 73 2 hmuekaaphitaekhrn 47 100 0 xangxing raykarkhxngaehlngxangxingaebngtampraeths hmayehtu khxmullasud n wnthirabu khwamthiinkarraynganaetlapraethsaetktangknip canwnraybukhkhlthiidrbwkhsinokhwid 19 xyangnxyhnungods ewnaetcarabuiwepnxyangxun rwmthungphuthiidrbkarchidwkhsinephiyngkhrngediywbangswn xacrwmthungkarchidwkhsinihkbaerngnganthiimichphlemuxngsungsamarththaihcanwnrwmthnghmdekin 100 khxngprachakrinthxngthin bangpraethsyngimrayngancanwnkarchidodsaerk karnbprimanodsthnghmdsahrbpraethsehlaniimrwmxyuinphlrwmkhxngolk 5 0 5 1 5 2 khxmulkhxngpraethsniaesdngthung canwnodsthnghmd imichkarchidodsaerkethann rwmkhxmulkhxngrthsmthbxisra inphlrwmkhxngshrth khxmulrwmcanwnkhxngnkhrrthwatikn enuxha 1 sarasakhyaelaprawti 1 1 sarsaelaemxrs 1 2 karphthnawkhsinokhwidinpi 2020 2 karphthnathwolk 2 1 Access to COVID 19 Tools ACT Accelerator aelaokhaewks 2 2 esphi 2 3 rthbalkhxngpraeths 3 karthdlxngkhxngxngkhkarxnamyolk 3 1 aebbthdlxngthiprbidsahrbkarthdlxngsxliaedriti 4 hunswn karaekhngkhn aelakaraeckcahnay 5 kahndewlatang thitxngyxlng 5 1 aephltfxrmethkhonolyi 6 wkhsin 6 1 wkhsinthiidxnumtiaelw 6 2 karthdlxngthangkhlinikthieriminpi 2020 6 3 nganwicyphrikhlinik 6 3 1 karthdlxngraya 1 thiwangaephninpi 2020 6 4 wkhsinthiimechphaaecaacngorkhokhwid 6 4 1 wkhsinbisici 6 5 karichtwesrim adjuvant 7 khxcakdaelapyhathixacekid 7 1 pyhakhwamplxdphythangchiwphaph 7 2 karephimvththikhxngechuxodyxasyphumitanthan ADE 7 3 prasiththisky efficacy 7 4 karrbsmkhrxasasmkhrephuxthdlxng 7 5 khaichcay 7 6 karaeckcahnay 7 7 karirkhxmulthiepidephyaelakhwamimechuxic 8 pyhakhxngkarsuksaaebb thathay thiesnx 9 karxnuyatihichepnkarchukechin EUA 9 1 bahern 9 2 aekhnada 9 3 emksiok 9 4 filippins 9 5 shrachxanackr 9 6 shrth 10 karihxnuyat 10 1 xngkhkarxnamyolk 10 2 xxsetreliy 10 3 shphaphyuorp 10 4 shrth 10 5 karsxdsxngphlkhxngyahlngcakwangtlad 11 prasiththisky 11 1 prasiththiphaph effectiveness 11 2 xtrakarchidwkhsinkhrxbkhlumwikvti 11 3 sayphnthukhxngiwrsokhwid 19 11 3 1 xlfa B 1 1 7 11 3 2 ebta B 1 351 11 3 3 aekmma P 1 11 3 4 edlta B 1 617 2 12 karwangtladaelakarekhathungxyangethaethiymkn 12 1 pyhakarwangtlad 12 2 xanacxthipity 12 3 karekhathungidxyangethaethiymkn 13 osxupthan 13 1 olcistiks 13 2 kalngkarphlit 13 3 oseyn cold chain 13 4 karkhnsngthangxakasaelathangbk 13 5 khwammnkhngplxdphyaelakhxrpchn 13 6 okhrngsrangphunthankhxngchati 14 khwamrbphidchxbtxphlitphnth 15 khxmulphid 16 duephim 17 echingxrrth 18 xangxing 19 xanephim 20 aehlngkhxmulxunsarasakhyaelaprawti aekikhsarsaelaemxrs aekikh miwkhsinpxngknorkhiwrsokhornainstwhlayxyang rwmthngorkhhlxdlmxkesbehtutidechuxiwrs infectious bronchitis virus innk orkhiwrsokhornainsunkh canine coronavirus aelaorkhiwrsokhornainaemw feline coronavirus 17 okhrngkarkxn thiphthnawkhsinsahrbiwrsinskul Coronaviridae thimnusytidechux mungichsahrbklumxakarthangedinhayicechiybphlnrunaerng sars hrux SARS aelaorkhthangedinhayictawnxxkklang emxrs hrux MERS odythngsxngidthdsxbinstwthdlxngaelw 18 19 tamwrrnkrrmnganwicythitiphimphinrahwangpi 2005 2006 aemrthbalaelaxngkhkrsatharnsukhtang thwolkcaidihkhwamsakhykbkarhaaelaphthnawkhsinbwkyaihm 20 21 22 aetcnthungpi 2020 kyngimmiwkhsinrksahruxpxngknorkhsarsthiaesdngwaplxdphyaelamiprasiththiphlinmnusy 23 24 orkhemxrskyngimmiwkhsindwy 25 emuxorkhemxrskalngrabad echuxknwa nganwicyekiywkborkhsarsthiidthaaelwxacepnokhrngaebbthimipraoychnephuxphthnawkhsinaelaphthnawithikarrksaorkh 23 26 cnthungeduxnminakhm 2020 miwkhsinorkhemxrschnidhnung xasydiexnex thiidphankarthdlxngthangkhlinikrayathi 1 kbmnusyaelw 27 aelamiwkhsinxik 3 xyang thikalngxyuinkrabwnkarodythnghmdepnwkhsinmiiwrsepnewketxr 2 xyangmixadioniwrs ChAdOx1 nCoV 19 BVRS GamVac epnewketxr aelaxikxyangmi modified vaccinia Ankara MVA epnewketxr 28 karphthnawkhsinokhwidinpi 2020 aekikh wkhsinpxngknorkhtidtximekhyphthnaidaebbichewlaimkipi aelakimmiwkhsinxair elythipxngknkartidiwrsokhornainmnusy 29 hlngcakidphborkhpxdbwmehtuiwrsokhornaaebbihmemuxeduxnthnwakhm 2019 30 kidtiphimphladbyinkhxngokhwid 19 emuxwnthi 11 mkrakhm 2020 sungcudchnwnkartxbsnxngchukechininradbnanachatiephuxetriymrborkhrabadaelaerngphthnawkhsinpxngknorkh 31 32 33 inplayeduxnkumphaphnth 2020 xngkhkarxnamyolkkhadwa camiwkhsinpxngkniwrsokhornasayphnthuihm SARS CoV 2 thiepnehtukhxngorkhxyangerwkichewla 18 eduxn 34 xtrakartidechuxthiephimkhunxyangrwderwkhxngokhwidthwolkemuxtnpi 2020 idkratunihkxphnthmitrradbnanachatiaelakratunihrthradmthrphyakrephuxphthnawkhsinhlaychnidinrayaewlasn 35 cungmiwkhsinaekhndiedt 4 xyangthierimkarthdlxnginmnusyineduxnminakhm dutarangkarthdlxngthangkhlinikthieriminpi 2020 txip 31 36 xngkhkarxnamyolkpraeminkhaichcaythnghmdthung 8 000 landxllarshrth praman 250 000 lanbath ephuxphthnawkhsinsamxyanghruxmakkwathimiethkhonolyiaelakarcdcahnaytang knephuxrangbkarrabadkhxngokhwidthwolk 35 cnthungeduxnemsayn 2020 kmi bristhaelasthabnekuxb 80 aehngin 19 praeths thikalngdaeninkarxnesmuxnkbsthankarntunthxngniaelw 37 ineduxnemsaynechnkn esphi CEPI idpraeminwaxacmiwkhsinaekhndiedttanorkhokhwidthung 6 xyang thiphnthmitrnanachatikhwreluxkphthnaihphankarthdlxngthangkhlinikrayathi 2 3 aela 3 xyang khwrchwyldraebiybrachkarthicukcikekinipihphankartrwcsxbkhxngrthaelakartrwcsxbkhunphaphid odycamikhaichcayxyangnxythung 2 phnlandxllarshrth praman 62 851 lanbath 38 36 29 swnnganwiekhraahxiknganhnungpraeminwa catxngphthnawkhsinaekhndiedtinebuxngtn phrxm kn 10 xyang kxncaeluxkephiyngimkixyangephuxphthnacnthungihxnumtiid 29 ineduxnkrkdakhm 2020 sunykhwammnkhngisebxraehngchatishrachxanackr bwkkbhnwyngankhwammnkhngkarsuxsartang khxngaekhnada sankngankhwammnkhngokhrngsrangphunthanaehngkhwammnkhngisebxrshrth Cybersecurity Infrastructure Security Agency aelasankngankhwammnkhngaehngchatishrth idrwmknklawhawankelngkhxmphiwetxrthipraethsrsesiysnbsnunidphyayamkhomynganwicyekiywkbkarrksaaelawkhsinokhwidcaksthabnwichakaraelasthabnyainpraethstang aetrsesiykidptiesthkhxklawhani 39 karphthnathwolk aekikhinchwngpi 2020 khwamepliynaeplngsakhykhxngkarphthnawkhsinokhwidcaktnpikkhux karephimkarrwmmuxknrahwangbristhyakhamchatikbrthbalkhxngpraethstang rupaebbbristhaelacanwnbristhethkhonolyichiwphaphinpraethstang thiidelngkhwamsnicipthiwkhsinokhwid 38 tamesphi emuxcaaenktamphumiphakh xngkhkrthiphthnawkhsinokhwidrxyla 40 xyuinthwipxemrikaehnuxethiybkbrxyla 30 inexechiyaelaxxsetreliy rxyla 26 inyuorp odymiokhrngkarcanwnnxyinxemrikaitaelaaexfrika 38 31 Access to COVID 19 Tools ACT Accelerator aelaokhaewks aekikh xngkhkrnanachatirwmthngxngkhkarxnamyolk esphi Coalition for Epidemic Preparedness Innovations CEPI kawi mulnithibilaelaemlindaekts aelarthbaltang idkxtngokhrngkar Access to COVID 19 Tools ACT Accelerator ephuxhaenginthun erngkarwicyaelaphthna karphlit aelakarekhathungxyangyutithrrmthwolksahrbchudtrwcokhwid withikarrksa aelakaridibxnuyatephuxphlitwkhsin odymiopraekrmphthnaodyechphaathieriykwa okhaewks COVAX Pillar 40 41 okhaewksmungxanwyihidibxnuyatephuxphlitwkhsinokhwidhlayxyang mungihmirakhathiyutithrrm mungihidwkhsinthung 2 000 lanods imekinplaypi 2021 ephuxpxngknbukhlakrthangaephthyphuepnhnwyhnaaelakhnthiesiyngmakthisud odyechphaasahrbpraethsthimirayidtacnthungpanklang 42 43 rwmthngpraethsithy cnthungeduxnthnwakhm 2020 okhrngkar ACT Accelerator rwm aelwidenginthunma 2 400 landxllarshrth praman 75 000 lanbath miwkhsinaekhndiedt 9 xyangthiidenginthuncakokhaewksaelaesphi cungcdepnklumthimiwkhsinokhwidmakthisud odymipraeths 189 praeths tklngwacarwmaephnkarphlitcdsngwkhsininthisud 44 45 intnpi 2020 xngkhkarxnamyolkidxxksuxsyyantxenuxngsungidsyyawacaidengin 8 000 landxllarshrth pramansxngaesnaepdhmunlanbath cakpraeths 40 praeths ephuxsnbsnunkarerngphthnawkhsin 46 ineduxnkrkdakhm xngkhkarprakaswapraeths 165 praeths sungmiprachakrthnghmdrxyla 60 khxngthngolkidtklngkbaephnkarkhxngokhaewksephuxihaeckcahnaywkhsinthiidxyangyutithrrmaelaethaethiymkn sungrbpraknwapraethsthiekharwmaetlapraethscaidswnaebngwkhsinephuxihaekprachakrthiesiyngsudrxyla 20 khxngpraethsimekinplaypi 2021 47 swnxngkhkrkarrwmmuxnganwicyolkephuxkhwametriymphrxmtxorkhtidtx Global Research Collaboration for Infectious Disease Preparedness kalngthanganxyangiklchidkbxngkhkarxnamyolkaelapraethssmachikephuxcdladbkhwamcaepninkaridthunkhxngnganwicytang ephuxprasannganrahwangxngkhkrnanachatiphuihthunkbxngkhkrthithanganwicy ephuxxpedtkhxmulekiywkbkhwamkawhnakhxngwkhsin aelaephuxhlikeliyngkarihthunsasxn 48 49 swnshphnthorkhthangedinhayicechiybphlnrunaerngaelakartidechuxxubtiihm International Severe Acute Respiratory and Emerging Infection Consortium twyx ISARIC kkalngcdraebiybaelaephyaephrkhxmulnganwicyekiywkbokhwidephuxihekidphltxnoybaysatharnsukhkhxngrthineruxngkaraeckcahnaywkhsinthicaid 50 inwnthi 4 mithunayn minganprachumsudyxdesmuxnthiprasanngancakkrunglxndxn miphuaethncakxngkhkrkhxngrthaelaexkchncakpraeths 52 praeths rwmthngpramukhaehngrth 35 than cakpraethsklum 7 aelaklum 20 ephuxradmengin 8 800 landxllarshrth pramansxngaesnaepdhmunlanbath ephuxsnbsnunihkawi phnthmitrolkephuxwkhsinaelakarihphumikhumkn etriymihwkhsinokhwidaekedk 300 lankhn inpraethsdxyphthnatlxdcnthungpi 2025 51 phubricakhrayihyrwmthngmulnithibilaelaemlindaekts 1 600 landxllarshrth hruxpramanhahmunlanbath 52 aelashrachxanackr 330 lanpxndsetxrlingtxpi epnewla 5 pi rwmepnenginpramanhkhmunhkphnlanbath 51 ineduxnthnwakhm mulnithibilaelaemlindaektsbricakhthrphyxik 250 landxllarshrth pramanecdphnaepdrxylanbath ihaek ACT Accelerator ephux snbsnunkarsngchudtrwcokhwid 19 karrksa aelawkhsinihm odyechphaaaekpraethsmirayidtaaelapanklang inchwngpi 2021 cungrwmkarbricakhthrphyekiywkbokhwidkhxngmulnithiepn 1 750 landxllarshrth praman 55 000 lanbath 53 54 esphi aekikh esphi Coalition for Epidemic Preparedness Innovations CEPI epnxngkhkrnanachatithicdtngkhuninpi 2017 mungthanganrwmkbecahnathisatharnsukhaelaphuphthnawkhsinnanachatiephuxphthnawkhsinpxngknorkhrabadtang 43 esphiidcdtngkxngthun 2 000 landxllarshrth praman 64 600 lanbath odyepnhunswnthwolkkbxngkhkrkhxngrth exkchn karkusl kbprachasngkhmephuxerngwicyaelathdlxngwkhsinaekhndiedt sahrbokhwid 9 xyang odymiepahmayihmihlayxyangphthnacnidxnumtiphayinpi 2020 21 38 36 44 shrachxanackr aekhnada ebleyiym nxrewy switesxraelnd eyxrmni aelaenethxraelndidbricakhengin 915 landxllarshrth pramansxnghmunekaphnlanbath aekesphiaelwintneduxnphvsphakhm 46 55 swnmulnithibilaelaemlindaekts sungmiepahmayindankarwicyaelakaraeckcahnaywkhsin idbricakhengin 250 landxllarshrth pramanecdphnekarxylanbath ihaekxngkhkarephuxnganwicyaelakarihkarsuksaaeksatharnchnineruxngwkhsinokhwid 56 57 tlxdkarrabadthwpi 2020 esphiidihenginthunphthnawkhsinaekhndiedt 9 xyangodytngicihmiethkhonolyiwkhsinhlayhlaktang knephuxldkhwamesiyngkarlmehlwsungpkticasungemuxphthnawkhsin 44 58 cnthungeduxnthnwakhm xngkhkraelaopraekrmkarwicythiidkarsnbsnuncakesphirwmaexstraesenka mhawithyalyxxksfxrd AZD1222 Clover Biopharmaceuticals SCB 2019 CureVac Zorecimeran CVnCoV Inovio INO 4800 sthabnpasetxr MV SARS CoV 2 omedxrna mRNA 1273 Novavax NVX CoV2373 SK bioscience GBP510 aelamhawithyalyhxngkng 44 59 60 rthbalkhxngpraeths aekikh rthbalkhxngpraethsthicdngbpramanephuxlngthuninpraethsaelatangpraethsekiywkbnganwicywkhsin nganphthna aelakarphliterimtninpi 2020 rwmthngrthbalklangkhxngaekhnada sungprakasthun 275 landxllaraekhnada pramanhkphnsirxylanbath sahrbokhrngkarnganwicywkhsin 96 okhrngkar thnginbristhaelainmhawithyaly odymiaephncasrang thnakharwkhsin ephuxfakwkhsiniwhlayxyangthisamarthichthaorkhrabadxik 61 62 yngmikarlngthunephimxik 1 100 landxllaraekhnada pramansxnghmunhkphnlanbath ephuxsnbsnunkarthdlxngthangkhlinikinaekhnadaaelwphthnaoskarphlitaelakaraeckcahnaysahrbwkhsin 49 wnthi 4 phvsphakhm rthbalaekhnadacdngbpraman 850 landxllaraekhnada pramansxnghmunlanbath ihaekxngkhkarxnamyolkenuxngkbkarxxksuxsyyantxenuxngephuxradmthun 8 000 landxllarshrth ihwkhsinokhwid 63 phngkhxngsankngan Government Accountability Office khxngshrth epriybethiybkarphthnawkhsinthrrmdakbithmilnthierngerwkhun rwm khux bn thw ipichewla 10 15 pi kwacaidxnumtiinshrth lang erng erwichewlaimkipi khaaeplkhraw caksayipkhwabnlnglang Exploratory karwicysubesaa Preclinic karthdlxngrayaphrikhlinik Clinical Trials karthdlxngthangkhlinikaebngepnraya FDA Review and Approval karphicarnaaelaxnumtiodyxngkhkarxaharaelayashrth Manufacturing karphlit FDA Rolling Review and Approval karphicarnaaelaxnumtithithaxyangtxenuxng Rapid Manufacturing karphlitxyangrwderw inpraethscin rthbalidihenginkumidxkebiytaaekphuphthnawkhsinphanthnakharklang aelahathidinihephuxihbristhsrangorngnganphlitwkhsin 55 cnthungeduxnmithunayn 2020 wkhsinaekhndiedt 6 xyangcak 11 xyangthikalngthdsxbebuxngtninmnusymacakxngkhkrkhxngcin 56 bristhwkhsinaelasthabnwicy 3 aehngidenginsnbsnuncakrthbalcinephuxkarwicy ephuxkarthdlxngthangkhlinik aelakarphlitwkhsinsungdithisud odyihkhwamsakhykbkaridhlkthanprasiththiskykhxngwkhsinerw yingkwakhwamplxdphy 64 wnthi 18 phvsphakhm cinidsyyawacaihengin 2 phnlandxllarshrth pramanhkhmunsamphnlanbath ephuxsnbsnunngankhxngxngkhkarxnamyolkephuxkacdokhwid 65 wnthi 22 krkdakhm cinidprakaswacaihenginku 1 phnlandxllarshrth praman 32 000 lanbath ephuxihpraethstang inlatinxemrika aelaaekhribebiynsamarthsuxwkhsincakcinid 66 wnthi 24 singhakhm naykrthmntricinhli ekhxechiyngprakaswa caaeckcahnaywkhsinkhxngcinihaekpraethsexechiyxakheny 5 praeths khuxkmphucha law emiynmar ithyaelaewiydnam kxnxunemuxidwkhsinaelw 67 inbrrdapraethsshphaphyuorp emuxeduxnphvsphakhm frngessprakaskarlngthun 4 9 landxllarshrth praman 154 lanbath inshphnthkarwicywkhsinokhwidphanesphi thixngkhkrtang rwmthngsthabnpasetxr frngess Themis Bioscience xxsetriy aelamhawithyalyphittsebirk shrth camibthbath sungephimthunkarphthnawkhsinokhwidkhxng CEPI epn 480 landxllarshrth pramanhmunhaphnlanbath 68 69 ineduxnminakhm khnakrrmathikaryuorpidlngthun 80 lanyuor praman 2 769 lanbath kb CureVac sungepnbristhethkhonolyichiwphaphkhxngeyxrmniephuxphthnawkhsinaebbexmxarexnex 70 swnrthbaleyxrmnexngkidlngthuntanghakkbbristhxik 300 lanyuor pramanhmunsiphnlanbath ineduxnmithunayn 71 ebleyiym nxrewy switesxraelnd eyxrmni aelaenethxraelndepnphubricakhraysakhyihaek CEPI ephuxwicywkhsinokhwidinyuorp 55 ineduxnemsayn rthbalshrachxanackrkxtngkhnakrrmkarwkhsinokhwidechphaakicephuxerngphthnawkhsinphankarrwmnganrahwangxutsahkrrm mhawithyaly kbxngkhkrtang khxngrthtlxdkhntxnkarphthnawkhsin rwmthngkahndorngphyabalinpraethsephuxthakarthdlxngthangkhlinik kdkarxnumti aelakarphlitinthisud 72 okhrngkarrierimphthnawkhsinthimhawithyalyxxksfxrdaelaximphieriylkhxlelclxndxnidrbngbpraman 44 lanpxndsetxrling pramanphnaepdrxylanbath ineduxnemsayn 73 74 sanknganwicyaelaphthnathangchiwewchkhnsungshrth Biomedical Advanced Research and Development Authority twyx BARDA xanwa barda epnxngkhkrkhxngrthbalklangshrththiihthunkbethkhonolyirksaorkh idprakaslngthunekuxb 1 000 landxllarshrth pramansamhmunhnungphnlanbath ephuxsnbsnunkarphthnawkhsinokhwid aelaetriymtwphlitwkhsinaekhndiedtthimihwngthisudinshrth wnthi 16 emsayn bardalngthun 483 landxllarshrth pramanhmunhaphnlanbath kbbristhomedxrna Moderna aelahunswnkhuxcxhnsnaexndcxhnsn 55 75 bardayngmingbpramanxik 4 000 landxllarshrth pramanaesnsamhmunlanbath sahrbphthnawkhsin dngnn cungxaclngthunphthnawkhsinaekhndiedtidthung 6 8 xyang thicathdlxngthangkhlinikinpi 2020 2021 odybristhtang echn Sanofi Pasteur frngess aela Regeneron shrth 75 76 inwnthi 15 phvsphakhm rthbalklangshrthidprakasihngbpramankbopraekrmerngdwnkhux Operation Warp Speed aeplidwa ptibtikarkhwamerwehnuxaesng odymungiherimthdlxngwkhsinaekhndiedtthangkhlinikinchwngvduibimrwngpi 2020 aelwphlitwkhsinthiidxnumti 300 lanods ihidineduxnmkrakhm 2021 phunaopraekrmniepnnayphlthharbkshrth ineduxnmithunayn phunaopraekrmaecngwa cathanganrwmkbbristh 7 bristh thikalngphthnawkhsinaekhndiedtsahrbokhwid khux omedxrna cxhnsnaexndcxhnsn emxrkh ifesxr aelamhawithyalyxxksfxrdthirwmmuxkbbristhaexstraesenka bwkkbbristhxiksxngbristh 77 aembristhifesxrphayhlngcarabuwa bristhimidyxmrbenginthun cakrth karlngthunephuxwicyaelaphthnakhxngifesxrthnghmdepnkaresiyng 78 karthdlxngkhxngxngkhkarxnamyolk aekikhineduxnemsayn 2020 xngkhkarxnamyolkidtiphimphaephnkarwicyaelaphthnaiwrsokhornaihm sungetriymaephn karwicythangkhlinikkhnadihy thainradbnanachati misunyhlaysuny thaaebbsum miklumkhwbkhum ephuxihsamarth praeminpraoychnaelakhwamesiyngkhxngwkhsinaekhndiedtaetlaxyangphrxm knphayin 3 6 eduxn thimiihichthdlxng aephnkarnimi ophriflphlitphnthepahmay Global Target Product Profile twyx TPP sungcaaenkkhunsmbtikhxngwkhsinthiplxdphyaelamiprasiththiphliwepn 2 hmwd khux wkhsinephuxkarpxngkninrayayawsahrbbukhkhlthiesiyngokhwidsungkwa echn bukhlakrthangkaraephthy aelawkhsinxun thiihphumikhumknxyangrwderwemuxekidkarrabadihm 35 xngkhkaryngidcdtngthimnanachati khux thiphiphi TPP khunephux praeminkarphthnawkhsinaekhndiedtthimixnakhtmaksud srangkhxmul aephnthiekiywkbwkhsinaekhndiedtaelakarthdlxngthangkhlinikkhxngwkhsinthwolk aelwtiphimphxpedtaephnkhxngwkhsinodyxpedtbxy 79 praeminaelatrwckhdwkhsinaekhndiedtthimixnakhtmaksudphrxm knxyangerwkxncathdsxbinmnusy xxkaebbaelaprasankarthdlxngaebbsumaelamiklumkhwbkhum mihlaysuny aelathainradbnanachatisungeriykwakarthdlxngsxliaedriti Solidarity trial 35 80 ephuxihsamarthpraeminpraoychnaelakhwamesiyngkhxngwkhsinaekhndiedttang thikalngthdlxngthangkhlinikinpraethsthimixtrakartidorkhokhwidsung aelwtikhwamaelaaechrphlthiidxyangrwderwthwolk 35 thimnanachatinicacdladbkhwamsakhywa wkhsinidkhwrekhasukarthdlxngthangkhlinikrayathi 2 aela 3 aelarabuophrothkhxl eknthwithikhxngkarthdlxngraya 3 aebbekhaknidsahrbwkhsinthnghmdthiekhasurayakxnidrbxnumtini 35 aebbthdlxngthiprbidsahrbkarthdlxngsxliaedriti aekikh aebbthdlxngthangkhlinikthikalngthaxyuxacprbidodyeriykwaepn adaptive design aebbprbid thakhxmulthiidinkarthdlxngihkhwamchdecntngaetenin ekiywkbprasiththiphlkhxngwkhsin imwacabwkhruxlb 81 82 dngnn karthdlxngrwm Solidarity trial khxngxngkhkarxnamyolksahrbwkhsinhlayxyangthithdlxngthangkhlinikinpi 2020 caichwithiechnniephuxihsamarthepliynpharamietxrkhxngkarthdlxngidxyangrwderwinsunythdlxngthukaehngemuxphlprakt 80 wkhsinaekhndiedtihmthiekhaeknthyngxacephimekhainopraekrmkarthdlxngrwm aelawkhsinaekhndiedtthipraktodyhlkthanwaplxdphyhruxmiprasiththiskyimdiethiybkbyahlxkaelawkhsinxun kcaykelikthdlxnginopraekrmni 80 aebbprbidthiichinkarthdlxngwkhsinaekhndiedtthangkhlinikrayathi 2 3 xacthaihrayakarthdlxngsnlngodymixasasmkhrphurbwkhsinnxykwa chwyerngkartdsinicimwacahyudkarthdlxngtngaettn hruxtdsinicwamiphl hlikeliyngthakarwicysa aelaephimkarprasannganephuxepliynaebbkarthdlxngthitharwminsunypraethstang 80 81 hunswn karaekhngkhn aelakaraeckcahnay aekikhbristhyayksihythimiprasbkarnphlitwkhsinepncanwnmak rwmthngcxhnsnaexndcxhnsn aexstraesenka aelaaeklkossmithikhln kalngsrangphnthmitrkbbristhethkhonolyichiwphaph rthbalkhxngpraethstang aelamhawithyalyephuxerngkarphthnawkhsinthimiprasiththiphaph 56 55 ephuxrwmsmrrthphaphthangkarenginaelakarphlitephuxsrangethkhonolyiwkhsinorkhrabadthwaebbichtwesrim adjuvant aeklkossmithikhlncungidcbmuxkbsaonfi sungepnhunswnaebbthiimkhxythaknrahwangbristhyksihynanachatiephuxerngphthnawkhsin 83 emuxokhwid 19 kalngrabadipthwxyangrwderwinpi 2020 xngkhkarnanachatiechnxngkhkarxnamyolkaelaesphi phuphthnawkhsin rthbal aelaxutsahkrrmkidpraeminkaraeckcahnaywkhsinthicaid 35 praethsphlitwkhsinaetlapraethsxacthukonmnawihkhaywkhsininrakhasungsud hruxichwkhsininpraethskhxngtnkxn 32 29 55 phuechiywchayennwa wkhsinthicaxnumtikhwrmirakhathiphxsuxidaelamiihsahrbbukhkhlhnwyhnainkarrksaphyabalaelakhnthicaepnmaksud 32 29 55 ineduxnemsayn edxaedliethlikraf lxndxn raynganwa shrachxanackridtklngthakarrwmkbpraethsaelaxngkhkrnanachatixun rwmthngpraethsfrngess eyxrmni aelaxitaliephuxkhnhawkhsinaelaaechrphlthiid aelatklngwa prachachnxngkvscaimidrbsiththiphiessephuxidwkhsinokhwidthimhawithyalyxngkvssungidrbenginphasikhxngprachachnepnphuphthnakhun 73 bristhhlayaehngmiaephnphlitwkhsinephuxerimtnkhayinrakhathuk aelwephimrakhaephuxihidkairphayhlngthatxngchidwkhsinthukpiaelaemuxpraethstang tunwkhsinephuxxnakht 55 xngkhkarxnamyolkaelaesphikalngsrangthrphyakrthangkarenginaelaaenwptibtiephuxsngwkhsinthimiprasiththiphl 3 xyanghruxyingkwaipthwolk odysanukwapraethstang aelaprachakrklumtang yxmcaepntangkn 31 35 36 80 yktwxyangechn wkhsinthimiprasiththiphlnacacdkxnxunihaekbukhlakrthangaephthyaelaklumprachakrthiesiyngpwyhnkaelaesiyngtaymaksudcakkartidorkh echn khnchrahruxkhncnthixyuinchumchnaexxd 84 85 thngxngkhkarxnamyolk esphi aelakawitangkidaesdngkhwamepnhwngwa praethsrarwyimkhwridwkhsinokhwidkxnpraethsxun aetkhwrphicarnakhwamcaepninhmuprachakraelakhwamcaepnephuxldpyhathangesrsthkic 31 36 84 kahndewlatang thitxngyxlng aekikhpraedntang thangphumirthsastr pyhakhxngklumprachakrthixxnaex aelapyhakarphlitwkhsinepnphn lanodslwnxackddnihyxkahndewlatang inkarphthnawkhsinaelainbangkrni xacrwmrayakarthdlxngthangkhlinikhlayrayaekhadwyknaelwthaphrxm knodyichewlaaekheduxn sungpktitxngthaepnladbtx knepnpi 56 yktwxyangechn phuphthnawkhsinpraethscinaelasunykhwbkhumaelapxngknorkhcin Chinese Center for Disease Control and Prevention iderimnganphthnawkhsinineduxnmkrakhm 2020 86 aetephiyngaekhthungeduxnminakhm kkalngtrwcduwkhsinaekhndiedtepncanwnmakodyichkahndewlathiyxlng aelamicudprasngkhephuxaesdngkhwamaekhngaekrngkhxngethkhonolyicinehnuxkhxngshrth aelaephuxihchawcinmnicthungkhunphaphwkhsinthiphlitincin 56 87 ephuxerngphthnawkhsininkahndewlayx sahrborkhrabadthw thngphuphthnawkhsinaelarthbalidyxmrbkhwamesiyngemuxldwngcrphthnawkhsinpkti 55 phubriharkhxngxutsahkrrmkhnhnungthungkbklawwa wikvtikarn khxngolkihycnkrathngeraaetlakhncatxngyxmesiyngthisudediywniephuxyutiorkhni 55 mieruxngthitxngphicarnahlayeruxngrwmthngradbkhwamepnphisthiyxmrbid khuxkhwamplxdphy kartngepathiklumprachakrthixxnaex khwamkawhnaxyangmakkhxngprasiththiskywkhsinthitxngmi rayakarpxngknkhxngwkhsin rabbkarsngyaphiess echn ihthangpakhruxthangcmuk aethnthicachid khnadkarihya khwamesthiyrkhxngwkhsinaelawithikarekbinkhlng karxnumtiihichepnkarchukechinkxnidrbxnumtithwip withikarphlitdithisudephuxihidwkhsinepnphn lanods aelakaraeckcahnaywkhsinthiidxnumti 29 88 thanberimcakkarthdlxngthangkhlinikrayathi 1 wkhsinthungrxyla 84 90 lmehlwinchwngphthnakaraelwimidrbxnumtiihwangtladkhay 31 89 thaerimcakkarthdlxngthangkhlinikrayathi 3 wkhsinrxyla 25 7 lmehlwaelaimidrbxnumtiodythisud 89 phuphlitwkhsinxaccalngthunipaelwekin 1 000 landxllarshrth pramansamhmunhnungphnlanbath odyidphlitwkhsinepnlan odsipaelwthiichimid 29 56 55 inkrnikhxngokhwid 19 odyechphaa prasiththiskykhxngwkhsinthixtrarxyla 70 xacphxrangbkarrabadthw ephraathamiprasiththiskyephiyngrxyla 60 karrabadkyngxactxipid aelaprasiththiskythinxykwarxyla 60 caimkxphumikhumknhmuphxrangbkarkracayechuxodytnexng 29 orkhthirabadthwinpi 2020 idsrangpyhakbsthabnwicyephraakarewnrayahangthangsngkhmaelakarpidhxngptibtikar 90 91 xupkrnekhruxngichthicaepnxyangyingsahrbkarwicyaelaphthnawkhsinkkhadaekhlnkhuneruxy enuxngcakkarsuxaekhngkhnkninradbnanachatihruxkarekhayudkhxngrth 64 kahndewlatang sahrbkarthdlxngthangkhlinik sungpktiepnkrabwnkarthithaepnladbtx knodyichewlaepnpi kkalngyxepnkarthdlxngtrwckhwamplxdphy prasiththisky aelahakhnadyathithaphrxm knodyichewlaepnaekheduxn sungxacmiphltxkhwamplxdphy 56 55 aephltfxrmethkhonolyi aekikh ineduxnknyayn 2020 nkwithyasastrkhxngesphiraynganwa miaephltfxrethkhonolyi 9 aephltfxrm thikalngwicyaelaphthnainchwngpi 2020 ephuxsrangwkhsintanokhwid 19 odyyngmiwkhsinaekhndiedtepncanwnmakthiimrabu aephltfxrmethkhonolyi 38 aephltfxrmodymaksahrbwkhsinthixyuinchwngthdlxngthangkhlinikcnthungeduxnknyaynidelngoprtin spike khxngiwrsaelarupaebbtang khxngoprtinniephuxichepnaexntiecnhlkinkarsrangphumikhumknorkh 38 aephltfxrmthikalngphthnainpi 2020 rwmethkhonolyikrdniwkhlixik khux exmxarexnexthiddaeplngniwkhlioxisd modRNA hruxdiexnex ewketxriwrsthiimkhyayphnthu ephpithd oprtincakyinlukphsm iwrsokhwidldvththithiyngepn aelaiwrsokhwidechuxtay 92 38 29 31 ethkhonolyiwkhsinthikalngphthnaephuxokhwidhlayxyangimehmuxnkbwkhsinpxngknikhhwdihythiichknxyuaelw aetcdepnkhxngihmthithanganechphaaecaacngkbklikkaraephrechuxkhxngokhwid 31 92 38 31 ethkhonolyithiichyngxacephimkhwamyudhyuninkarcdkaraexntiecn aelabangxyangxacmiprasiththiphldikwainklumprachakryxytang rwmthngkhnchra edk hyingmikhrrph aelakhnikhthiphumitanthanxxnaex 38 31 wkhsinaekhndiedtthixacsrangoprtinkhxngiwrs SARS CoV 2 aelwthaihphumikhumkntxbsnxngrwmthng 1 exmxarexnex thiekharhsyinkhxngiwrsokhwid 19 sungthaihesllsrangoprtinkhxngiwrs 2 epn oprtinthiphiwhumiwrsokhwid 19 thiphlitcakyinlukphsm 3 ewketxriwrs thimiyinkhxngokhwid 19 sungthaihesllsrangoprtinkhxngiwrs phngaesdngkarthangankhxngwkhsinxarexnex sungepnethkhonolyiihmchnidhnungthiichinwkhsinokhwid 19 rwmthngkhxngbristhifesxr ibxxnethkhaelakhxngbristhomedxrna exmxarexnex sungxacbrrcuxyuinxnuphakhnaon thiepnliphid caekhaipinesllaelwidkaraeplrhsepnoprtinkhxngiwrsokhwid 19 sungkxkartxbsnxngcakphumikhumkn aelwthaihphumikhumknruckoprtinkhxngiwrs emuxtidechuxokhwid 19 inxnakht kcatxbsnxngtxechuxidxyangekhmaekhngaelarwderw sthitiwkhsinokhwid 19 sahrbethkhonolyitang k ph 2021 4 ethkhonolyi I aekhndiedt thikalngthdlxng inmnusy thiidxnumtiin xyangnxy 1 praeths praethsthi xnumtiihichewketxriwrsthiimkhyayphnthu II 35 4 III 4 55ichxarexnex IV 36 3 III 2 42iwrsokhwid 19 echuxtay V 19 5 III 3 25hnwyyxyoprtinkhxngiwrsokhwid 19 VI 80 4 III 1 2ichdiexnex VII 23 2 III 0 0xnuphakhkhlayiwrs VIII 19 1 0 0ewketxriwrsthiyngkhyayphnthu IX 23 0 0 0iwrsokhwid 19 epn aetldvththiaelw X 4 0 0 0 miwkhsinaekhndiedthlaysibchnidthiimrabuethkhonolyi 4 Non replicating viral vector 3 0 3 1 3 2 3 3 3 4 miwkhsinaekhndiedthnungxyanghruxmakkwainkarthdlxngrayathi 2 hrux 2 3 RNA based Inactivated virus Protein subunit DNA based Virus like particle Replicating viral vector Live attenuated viruswkhsin aekikhcnthungwnthi 21 thnwakhm praeths 17 praeths B aelashphaphyuorp 110 idxnumtiihichwkhsinkhxngbristhifesxr ibxxnethkhkhux tozinameran epnkarchukechin bahernyngxnumtiihwangtladkhaychukechinsahrbwkhsin BBIBP CorV khxngbristhsionfarm 94 odyshrthxahrbexmiertstxmakidthaechnkn 95 inshrachxanackrcnthungwnthi 16 thnwakhm khn 138 000 khnidrb tozinameran inxathityaerkkhxngopraekrmkarchidwkhsinkhxngpraeths 111 inwnthi 11 thnwakhm 2020 xngkhkarxaharaelayashrthidxnuyatihich tozinameran epnkarchukechin 112 xikxathitytxma kihxnuyatechnknkbwkhsin mRNA 1273 khxngbristhomedxrna cungepnpraethsaerkthixnuyatihichwkhsin 2 xyangepnkarchukechin 113 114 115 esphicdrayakarphthnawkhsinepnsamklum khux 1 rayakarsarwc exploratory khuxkarwangaephnaelaxxkaebbwkhsinodyimmikarpraemininsingmichiwit 2 phrikhlinik preclinical khuxkarpraemininsingmichiwitaelaetriymtwphlitsarprakxbephuxcathdsxbinmnusy hrux 3 thierimthdsxbkhwamplxdphyinmnusyxasasmkhrthisukhphaphdirayathi 1 aelw 38 cnthungklangeduxnknyayn miwkhsinaekhndiedt 321 xyangthiidyunynaelwwakalngthdlxngthangkhlinik hruxwaepnokhrngkarsarwchruxphrikhlinik 38 karthdlxngrayathi 1 odyhlkthdsxbkhwamplxdphyaelakhnadyaepnebuxngtnodyihyaaekxasasmkhrsukhphaphdiepnsib khn rayathi 2 sungthahlngprasbkhwamsaercinrayathi 1 catrwcptikiriyakhxngphumikhumkn khnadkhxngya khuxtrwcprasiththiskyodyichkhawdkhxngsarbngchithangchiwphaph khux biomarker aelaphlthiimphungprasngkh pktithakbkhnepnrxy khn 116 117 karthdlxngraya 1 2 thdsxbkhwamplxdphyaelakartxbsnxngkhxngphumikhumkninebuxngtnodycakahndkhnadthiidphlihaemnyadwy 117 swnkarthdlxngrayathi 3 pkticamixasasmkhrmakkwa miklumkhwbkhum aelathdsxbprasiththiphlpxngknorkhkhxngwkhsin epnkarthdlxngaebbaethrkaesng khux interventional aelacaefasngektphlthiimphungprasngkhemuxichkhnadyathidisud 116 117 niyamkhxngkhwamplxdphykhxngwkhsin prasiththisky cudyutithangkhlinik clinical endpoint inkarthdlxngrayathi 3 xactangknrahwangbristhtang echnkarniyamradbphlkhangekhiyng kartidechux hruxkaraephrechux aelawa wkhsinpxngknkartidechuxokhwidaebbrunaernghruxaebbpanklang 118 119 120 wkhsinthiidxnumtiaelw aekikh xngkhkrkhwbkhumkhxngpraethstang idxnumtiihichwkhsin 11 chnidepnkarchukechin incanwnnn 6 chnididrbxnumticakxngkhkrkhwbkhumthixngkhkarxnamyolkcdwamiraebiybekhrngkhrd stringent regulatory authorities xyangnxy 1 aehng wkhsinxarexnex ifesxr omedxrna wkhsinmiewketxrepnxadioniwrs aexstraesenka sputnikwi cxhnsnaexndcxhnsn Ad5 nCoV sputnikilth wkhsinechuxtay sionfarm BBIBP sionaewk CoviVac okhaewksin sionfarm WIBP xun wkhsinsbyunit EpiVacCorona Zifivax Abdala Soberana 02wkhsinthixnumtiepnkarchukechinhruxihichthwip wkhsinaekhndiedt phuphthna phuihthun khxngpraeths ethkhonolyi canwnods rayahang xunhphumiekb karthdlxngkxnwangtlad canwnxasasmkhr karthdlxnghlngwangtlad canwnxasasmkhr aexstraesenka Vaxzevria Covishield wbr 121 a b 125 126 127 mhawithyalyxxksfxrd aexstraesenka esphi shrachxanackr swiedn xadioniwrskhxngchimaepnsithiaeplngephuxichepnewketxr ChAdOx1 wbr 125 2 ods 4 12 spdah wbr 128 2 8 C wbr 129 raya 3 30 000 wbr karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxkephuxtrwcprasiththisky khwamplxdphy aelakartxbsnxngkhxngphumikhumkn 130 sthana prasiththiskyxyuthirxyla 76 hlngcakodsaerkaelarxyla 81 hlngcakodsthisxngodychidhangkn 12 spdahhruxyingkwa 131 raya 4 10 000 wbr 132 karrksathiimidcdklumodysum c ifesxr Comirnaty d wbr 96 133 134 ibxxnethkh ifesxr eyxrmni shrth xarexnex exmxarexnexthiddaeplng niwkhlioxisd e humdwyxnuphakhnaonthiepnliphid 2 ods 3 4 spdah wbr 135 f 70 10 C wbr g tuaechaekhngphiess raya 3 43 998 wbr 140 karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk sthana phlbwkthiphbcakkarwiekhraahinrahwangkarthdlxngidprakasemuxwnthi 18 ph y 2020 141 aelwtiphimphinwnthi 10 th kh 2020 odyraynganprasiththiskythwipthungrxyla 95 142 143 raya 4 10 000 wbr 132 karrksathiimidcdklumodysum c cxhnsnaexndcxhnsn 144 145 Janssen Pharmaceutica hnwyngankhxngcxhnsnaexndcxhnsn BIDMC shrth enethxraelnd ewketxrepnxadioniwrslukphsmthiimkhyayphnthu Ad26 wbr 146 1 ods 147 2 8 C 147 raya 3 40 000 wbr karthdlxngaebbsum xaphrangsxngfay miklumkhwbkhumodyichyahlxk sthana phlbwkcakkarwiekhraahinrahwangkarthdlxngidprakasinwnthi 29 m kh 2021 wkhsinmiprasiththiskypxngknkartidorkhaebbmixakarxxncnthungpanklangrxyla 66 rxyla 64 inaexfrikaitcnthungrxyla 72 inshrth aelaaebbmixakarhnkrxyla 85 148 149 BBIBP CorV wbr 150 hnwyngankhxngsionfarm khux Beijing Institute of Biological Products cin iwrsokhwid 19 echuxtay ephaain vero cell wbr 150 2 ods 3 4 spdah wbr 151 2 8 C wbr 152 raya 3 48 000 wbr karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk xaphrangthngsxngfay thakhukhnan ephuxtrwckhwamplxdphyaelaprasiththiskyinkarpxngknorkh sthana phlkarthdlxngthitrwcsxbodyphuruesmxknrabuwawkhsinmiprasiththiskypxngknkartidechuxaebbaesdngxakarthirxyla 78 1 153 omedxrna Spikevax wbr 154 155 omedxrna NIAID BARDA esphi shrth exmxarexnex exmxarexnexthiddaeplng niwkhlioxisd e humdwyxnuphakhnaonthiepnliphid 156 2 ods 4 spdah wbr 157 f 20 5 C wbr 158 tuaechaekhngya raya 3 30 000 wbr karthdlxngaebbsumaelamiklumkhwbkhumthiichyahlxkephuxthdsxbprasiththisky khwamplxdphy aelakartxbsnxngkhxngphumikhumkn sthana phlbwkthiphbcakkarwiekhraahinrahwangkarthdlxngidprakasemuxwnthi 15 ph y 2020 159 aelwtiphimphwnthi 30 th kh 2020 odyraynganprasiththiskykhxngwkhsinthirxyla 94 1 160 raya 4 10 000 wbr 132 karrksathiimidcdklumodysum c sputnikwi Gam COVID Vac sthabnwicyrabadwithyaaelaculchiwwithya kamaeliy rsesiy ewketxrepnxadioniwrslukphsmthiimkhyayphnthu Ad5 aela Ad26 wbr 161 2 ods 3 spdah wbr 162 18 C wbr h tuaechaekhngya raya 3 40 000 wbr karthdlxngaebbsum xaphrangsxngfay miklumkhwbkhumodyichyahlxk ephuxtrwcprasiththisky kartxbsnxngkhxngphumikhumkn aelakhwamplxdphy 164 sthana karwiekhraahphlkarthdlxnginrahwangthitiphimphinwarsarkaraephthyedxaaelnsitrabuprasiththiskykhxngwkhsinthirxyla 91 6 odyimmiphlkhangekhiyngekinpkti 165 okhornaaewk 166 167 168 sionaewk cin iwrsokhwid 19 echuxtay ephaain vero cell wbr 166 2 ods 2 4 spdah wbr 169 2 8 C wbr 170 raya 3 33 620 wbr karthdlxngaebbsum xaphrangsxngfay miklumkhwbkhumodyichyahlxk ephuxtrwcprasiththiskyaelakhwamplxdphy sthana phlkarthdlxngthangkhlinikrayathi 3 inturkisungidthbthwnodyphuruesmxknaelwaesdngprasiththiskythirxyla 83 5 171 ngansuksahnunginchiliaesdngprasiththiskypxngknrxyla 65 sahrbkartidechuxthiaesdngxakar rxyla 87 sahrbkarekha rph rxyla 90 sahrbkarekhahxngixsiyu aelarxyla 86 sahrbkaresiychiwit 172 173 swnnganinbrasilrabuwamiprasiththiskypxngknrxyla 50 7 sahrbkartidechuxthiaesdngxakarthnghmd rxyla 83 7 sahrbkartidechuxthimixakareba aelaetmrxysahrbkarmixakarhnk 174 raya 4 37 867 wbr 175 176 karrksaokhaewksin BBV152 phartaiboxethkh sphawicythangkaraephthyaehngxinediy xinediy iwrsokhwid 19 echuxtay ephaain vero cell wbr 177 2 ods 4 spdah wbr 178 2 8 C wbr 178 raya 3 25 800 wbr karthdlxngaebbsum xaphrangphusngektkarn miklumkhwbkhumodyichyahlxk 179 sthana bristhraynganwa phlrahwangkarthdlxngthangkhlinikrayathi 3 phbwawkhsinmiprasiththiskyrxyla 78 180 raya 4 1 000 wbr 181 karrksathiimidcdklumodysum c sputnikilth sthabnwicyrabadwithyaaelaculchiwwithya kamaeliy 182 rsesiy ewketxrepnxadioniwrslukphsmthiimkhyayphnthu Ad26 183 1 ods 183 2 8 C 184 raya 3 7 000 wbr 185 karthdlxngaebbsumaelamiklumkhwbkhumthiichyahlxk xaphrangthngsxngfay 183 Convidicea wbr aekhnsioniboxlxciks Beijing Institute of Biotechnology of the Academy of Military Medical Sciences 186 cin ewketxrepnxadion iwrslukphsm Ad5 i wbr 187 1 ods 188 2 8 C 188 raya 3 40 000 wbr karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk xaphrangthngsxngfay thahlaysunythwolk ephuxtrwcprasiththisky khwamplxdphy aelakartxbsnxngkhxngphumikhumkn sthana ineduxnkumphaphnth 2021 karwiekhraahphlkarthwolkinrahwangphbprasiththiskykhxngwkhsinthirxyla 65 7 txorkhokhwid 19 thimixakar aelarxyla 90 98 sahrborkhxakarrunaerng 188 WIBP CorV hnwyngankhxngsionfarm khux Wuhan Institute of Biological Products cin wkhsiniwrsokhwid 19 echuxtay ephaain vero cells 2 ods 3 spdah wbr 189 190 191 2 8 C raya 3 51 600 wbr karthdlxngaebbsumaelamiklumkhwbkhumthiichyahlxk xaphrangthngsxngfay 192 sthana phlngankarthdlxngthiidthbthwnodyphuruesmxknaelwaesdngprasiththiskypxngknkartidechuxthiaesdngxakarthirxyla 72 8 153 EpiVacCorona wbr 193 194 sthabnewktxr rsesiy hnwyyxyephpithdkhxngiwrsokhwid 19 j wbr 193 2 ods 3 spdah wbr 193 2 8 C wbr 195 raya 3 40 150 tamaephn 3 000 erim wbr 196 karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk xaphrangthngsxngfay ephuxpraeminprasiththisky kartxbsnxngkhxngphumikhumkn aelakhwamplxdphyZF2001 ZIFIVAX 4 Anhui Zhifei Longcom Biopharmaceutical Co Ltd cin hnwyyxyoprtinaebblukphsmkhxngiwrsokhwid 19 k 3 ods 30 wn wbr 197 198 2 8 C wbr 199 raya 3 29 000 wbr karthdlxngaebbsumaelamiklumkhwbkhumthiichyahlxk xaphrangthngsxngfay 197 Abdala BioCubaFarma Center for Genetic Engineering and Biotechnology khiwba swnyxyiwrsokhwid 19 l 3 ods 2 spdah wbr 200 2 8 C wbr 201 raya 3 48 290 wbr 202 karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk thainhlaysuny xaphrangthngsxngfay 200 CoviVac 203 The Chumakov Centre thiwithyasastrbnthitysthanrsesiy rsesiy iwrsokhwid 19 echuxtay ephaain vero cells wbr 204 2 ods 2 spdah wbr 205 2 8 C wbr 205 raya 3 32 000 wbr 206 karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk xaphrangthngsxngfay ephuxtrwcprasiththiskyaelakhwamplxdphyQazCovid in QazVac 207 Research Institute for Biological Safety Problems khaskhsthan iwrsokhwid 19 echuxtay 2 ods 3 spdah wbr 208 2 8 C wbr 209 raya 3 3 000 wbr karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk xaphrang 210 Minhai COVID 19 vaccine KCONVAC Minhai Biotechnology Co Shenzhen Kangtai Biological Products Co Ltd cin iwrsokhwid 19 echuxtay ephaain vero cell 2 ods 4 spdah wbr 211 2 8 C raya 3 28 000 wbr 211 karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk xaphrangthngsxngfayCOVIran Barakat COVIRAN 212 Barakat Pharmaceutical Group Shifa Pharmed Industrial Group xihran iwrsokhwid 19 echuxtay 2 ods 4 spdah wbr 213 2 8 C raya 3 30 500 wbr raya 2 3a 20 000 karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk thaaebbkhukhnan 213 raya 3b 10 500 214 Covidful Chinese Academy of Medical Sciences COVID 19 vaccine wbr 215 216 Chinese Academy of Medical Sciences Institute of Medical Biology cin iwrsokhwid 19 echuxtay 2 ods 2 spdah wbr 216 2 8 C raya 3 34 020 wbr karthdlxngaebbmiklumkhwbkhumodyichyahlxk thathisunyediyw xaphrangthngsxngfaySoberana 02 FINLAY FR 2 wbr BioCubaFarma Instituto Finlay de Vacunas khiwba swnyxyiwrsokhwid 19 l khxncuekt 2 ods 4 spdah wbr 217 2 8 C wbr 201 raya 3 44 010 wbr 218 217 karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk thainsunyhlaysuny thaaebbkhukhnan xaphrangthngsxngfay karthdlxngthangkhlinikthieriminpi 2020 aekikh wkhsinaekhndiedtsahrbokhwid 19 thikalngthdlxnginraya 1 3 4 219 79 wkhsinaekhndiedt phuphthna phuihthun ethkhonolyi rayathdlxnginpccubn canwn rupaebbkarthdlxng rayathdlxngthiesrcaelw m canwn kartxbsnxngkhxngphumikhumkn phlimphungprasngkh rxkarxnumtiNVX CoV2373 wbr 220 onwaaewks esphi xnuphakhoprtin spike lukphsmkhxngiwrsokhwid 19 bwkkbtwesrim raya 3 15 000 wbr karthdlxngaebbsum xaphrangphusngektkarn miklumkhwbkhumodyichyahlxk 221 aehlng shrachxanackr xinediy 15 000 222 shrth emksiok 30 000 223 raya 1 2 131 wbr kartxbsnxngkhxngsarphumitanthanaebbkacdvththiaela IgG emuxichtwesrimaelahlngcakchidyaephim phlimphungprasngkh xakarekidinrayasnaelaeba khuxecbthicudchid pwdhw la aelapwdklamenux 224 aekhnada 225 shphaphyuorp 226 Zorecimeran CVnCoV 227 CureVac esphi wkhsinxarexnexaebbimddaeplng 228 raya 3 36 500 wbr 229 raya 2b 3 thdsxbprasiththiskyaelakhwamplxdphy thainsunyhlaysuny aehlng xarecntina ebleyiym okhlxmebiy satharnrthodminikn frngess eyxrmni emksiok enethxraelnd panama epru sepn chwngewla ph y 2020 raya 1 2 944 wbr 227 230 raya 1 284 karthdlxngaebbmiklumkhwbkhum xaphrangphusngektkarnbangswn odyephimkhnadya dose escalation ephuxthdsxbkartxbsnxngthangphumikhumknaelaphlthiimphungprasngkh raya 2a 660 karthdlxngaebbmiklumkhwbkhum xaphrangphusngektkarnbangswn thathisunyhlaysuny ephuxyunynkhnadya aehlng ebleyiym P1 eyxrmni P1 panama 2a epru 2a chwngewla mi y 2020 t kh 2021 xnumti shphaphyuorp 231 ZyCoV D wbr 232 Cadila Healthcare phlasmidkhxngdiexnexthiaesdngxxkoprtin S khxngiwrsokhwid 19 raya 3 26 000 wbr 233 aehlng xinediy 234 chwngewla m kh 2021 raya 1 2 1 000 wbr karthdlxngaebbsum xaphrangthngsxngfay miklumkhwbkhumodyichyahlxk 235 236 aehlng xinediy chwngewla k kh 2020 m kh 2021CoVLP 237 Medicago aeklkossmithikhln xnuphakhkhlayiwrsthiidcakphuch ichdiexnexlukphsm n aelaichtwesrim AS03 cakaeklkossmithikhln raya 2 3 30 612 wbr karthdlxngaebbsum xaphrangphusngektkarn miklumkhwbkhumodyichyahlxk aela event driven 239 aehlng aekhnada chwngewla ph y 2020 em y 2022 raya 1 180 wbr ekidsarphumitanthanaebbkacdvththiinwnthi 42 hlngkarchidyakhrngthi 1 wnthi 21 hlngchidyakhrngthi 2 inradbepn 10 ethakhxngphurxdchiwitcakkartidorkhokhwid 240 241 IIBR 100 Brilife wbr 242 sthabnwicychiwphaphxisraexl wkhsinmiewketxriwrsepn vesicular stomatitis virus lukphsm raya 2 1 000 wbr 243 aehlng xisraexl chwngewla th kh 2020 vduibimphli 2021 raya 1 80 wbr 242 xasasmkhr xayu 18 55 pi cdodysumihidrbwkhsinhnungkhrnginkhnadnxy klang hruxmak hruxidnaeklux hruxidrbwkhsinsxngodsinkhnadnxy hruxnaeklux hangkn 28 wn aehlng xisraexl chwngewla t kh ph y 2020FINLAY FR 2 SOBERANA 02 wbr Instituto Finlay de Vacunas Conjugate vaccine raya 2 910 wbr 244 karthdlxngaebbsumaelamiklumkhwbkhumodyichyahlxk xaphrangthngsxngfay epnngansuksaaebbkhnan raya 1 40 wbr 245 epnkarthdlxngaebbimsumaelaimmiklumkhwbkhum imxaphrang epnkarthdlxngaebbprbid adaptive aelathatamladb sequential INO 4800 wbr o 246 247 Inovio Pharmaceuticals esphi sthabnsukhphaphaehngchatiekahli International Vaccine Institute wkhsindiexnex phlasmidkhxngdiexnexsngdwywithi electroporation p raya 1 2 40 wbr aehlng shrth ekahliit chwngewla em y ph y 2020AG0301 COVID19 wbr 250 AnGes Inc 251 Japan Agency for Medical Research and Development wkhsindiexnex phlasmidkhxngdiexnex q raya 1 2 30 wbr karthdlxngimsum thathisunyediyw ihyasxngkhrng aehlng oxsaka chwngewla mi y 2020 k kh 2021 phrikhlinik wbr Lunar COV19 ARCT 021 252 253 Arcturus Therapeutics Duke NUS Medical School wkhsinexmxarexnex raya 1 2 92 wbr karthdlxngaebbsum xaphrangthngsxngfay aehlng singkhopr chwngewla s kh 2020 phrikhlinik wbr VLA2001 254 255 Valneva iwrsokhwid 19 echuxtay raya 1 2 150 wbr karthdlxngaebbsum xaphrangthngsxngfay thathisunyhlaysuny aehlng shrachxanackr chwngewla th kh 2020 k ph 2021 phrikhlinik wbr COVID 19 aAPC wbr 256 Shenzhen Genoimmune Medical Institute 257 wkhsinmielnthiiwrsepnewketxr r with minigene modifying aAPCs raya 1 100 wbr aehlng emuxngechinecin chwngewla mi kh 2020 2023 phrikhlinik wbr LV SMENP DC wbr 258 Shenzhen Genoimmune Medical Institute 257 wkhsinmielnthiiwrsepnewketxr r with minigene modifying DCs raya 1 100 wbr aehlng emuxngechinecin chwngewla mi kh 2020 2023 phrikhlinik wbr LNP nCoVsaRNA wbr 259 hnwy Medical Research Council Clinical Trials Unit thiximphieriylkhxlelc lxndxn wkhsinexmxarexnex raya 1 105 wbr karthdlxngrayathi 1 aebbsumodythdlxngephimkhnadya 15 aelwkhyayephuxtrwcsxbkhwamplxdphy xyangnxy 200 aehlng shrachxanackr chwngewla mi y 2020 k kh 2021 phrikhlinik wbr GRAd COV2 wbr 260 261 ReiThera Lazzaro Spallanzani National Institute for Infectious Diseases wkhsinxadioniwrskhxngchimaepnsithiddaeplng GRAd ephuxepnewketxr raya 1 90 wbr 262 xasasmkhr mi 2 klumaebngtamwykhux 18 55 piaela 65 85 pi cdodysumihidrbwkhsinsungihephimkhun hnunginsamxyang hruxihyahlxk aelwtrwctidtamepnewla 24 spdah xasasmkhrrxyla 92 5 thiidwkhsinekidsarphumitanthan aehlng krungorm chwngewla s kh th kh 2020 phrikhlinik wbr GX 19 wbr 263 264 Genexine consortium 265 International Vaccine Institute wkhsindiexnex raya 1 40 wbr aehlng krungosl chwngewla mi y 2020 mi y 2022 phrikhlinik wbr SCB 2019 wbr 266 267 Clover Biopharmaceuticals 268 aeklkossmithikhln esphi wkhsinhnwyoprtinyxy spike protein trimeric subunit with GSK adjuvant raya 1 150 wbr aehlng emuxngephirth chwngewla mi y 2020 mi kh 2021 phrikhlinik wbr COVAX 19 wbr 269 Vaxine Pty Ltd 270 wkhsinhnwyoprtinyxy oprtincakyinlukphsm s raya 1 40 wbr aehlng emuxngaexdield chwngewla mi y 2020 k kh 2021 phrikhlinik wbr imidtngchux wbr 271 PLA Academy of Military Science Walvax Biotech 272 wkhsinexmxarexnex raya 1 168 wbr aehlng cin chwngewla mi y 2020 th kh 2021 phrikhlinik wbr HGC019 wbr 273 Gennova Biopharmaceuticals HDT Biotech Corporation 274 wkhsinxarexnex raya 1 120 wbr 275 aehlng xinediy chwngewla m kh 2021 phrikhlinik wbr Bangavax wbr 276 277 Globe Biotech Ltd of Bangladesh wkhsinxarexnex raya 1 100 wbr 276 278 Randomized Parallel Group Trial phrikhlinik wbr imidtngchux wbr 279 Biological E Limited Baylor College of Medicine 280 iwrsokhwid 19 echuxtay raya 1 2 360 wbr 281 karthdlxngaebbsum miklumkhnan aehlng xinediy chwngewla ph y 2020 k ph 2021 phrikhlinik wbr Nano Covax 282 Nanogen Pharmaceutical Biotechnology JSC wkhsinoprtin spike lukphsm t 283 raya 1 60 wbr 282 phrikhlinik wbr sthana thdsxbkbhnu aehmsetxr aelaling krathrwngsatharsukhewiydnamxnumtiihichinkarthdlxnginmnusy 283 PTX COVID19 B 284 Providence Therapeutics wkhsinxarexnex raya 1 60 wbr 284 phrikhlinik wbr COVAC 2 285 VIDO University of Saskatchewan wkhsinhnwyyxyoprtin raya 1 108 wbr 285 phrikhlinik wbr SARS CoV 2 Sclamp V451 wbr 286 287 mhawithyalykhwinsaelnd Syneos Health esphi Seqirus swnkhxng CSL Limited oprtin spike thaihesthiyrdwy molecular clamp bwkkbtwesrim MF59 Terminated 120 wbr karthdlxngaebbsumaelaichyahlxk xaphrangthngsxngfay trwchakhnadya sthana idphlbwklwngemuxtrwciwrsexchixwiinxasasmkhr aehlng brisebn chwngewla k kh t kh 2020V590 288 aela V591 MV SARS CoV 2 289 emxrkh Themis BIOscience sthabnpasetxr University of Pittsburgh s Center for Vaccine Research CVR CEPI Terminated wbr sthana karthdlxngrayathi 1 phbkartxbsnxngkhxngphumikhumkninradbxxnkwathiphbinkartidechuxcring aelathiphbinwkhsinokhwid 19 xun 290 sthabnesrumaehngxinediy Serum Institute of India caepnphuphlitwkhsin ChAdOx1 nCoV 19 ihaekxinediy 122 praethsrayidtaaelapanklangxun 123 chuxichthimhawithyalykhux ChAdOx1 nCoV 19 sthabn Oswaldo Cruz Foundation caepnphuphlitinbrasil 124 3 0 3 1 3 2 3 3 Interventional non randomised ichchuxwa BNT162b2 emuxyngimidxnumti 5 0 5 1 Nucleoside modified messenger RNA twyx modRNA 6 0 6 1 niepnrayahangthiaenana aetodsthisxngkhxngifesxraelaomedxrnasamarthchididchasud 6 spdahhlngodsaerkthakhadaekhlnwkhsin 136 137 khxngifesxrsamarthekbepnrayayawinxunhphumirahwang 25 aela 15 xngsaeslesiys 13 aela 5 xngsafaerniht cnthung 2 spdahkxncaich aelarahwang 2 aela 8 xngsaeslesiys 36 aela 46 xngsafaerniht idcnththung 5 wnkxncaich 138 139 niepnxunhphumithiichekb Gam COVID Vac sutraechaekhng aetsutrthaaehngeyuxkaekhng khux Gam COVID Vac Lyo samarthekbiwrahwangxunhphumi 2 8 xngsaseslesiys 163 Recombinant adenovirus type 5 vector Subunit peptide Recombinant subunit vaccine 12 0 12 1 Subunit vaccine rayalasudthiidtiphimphphl xnuphakhkhlayiwrs virus like particles thikxinphuchpracathinxxsetreliy Nicotiana benthamiana sungxyuinskulediywknkbyasub 238 raya 1 2 inekahliitthaphrxmkbraya 1 inshrth electroporation hrux electropermeabilization hrux electrotransfer epnethkhnikhthangculchiwwithyathiprakbsnamiffakbesllephuxephimsphaphihsumphanidkhxngeyuxhumesll cungthaihsarekhmi ya hruxdiexnexekhaipinesllid 248 249 DNA plasmid 18 0 18 1 Lentiviral vector vaccine Recombinant protein recombinant spike protein nganwicyphrikhlinik aekikh ineduxnemsayn xngkhkarxnamyolkaethlngkarnodyepntwaethnkhxngnkwithyasastrklumtang thwolkwacarwmmuxknephuxerngphthnawkhsinpxngknorkhokhwid 291 odychkchwnxngkhkrtang rwmthngxngkhkrthikalngphthnawkhsinaekhndiedt xngkhkrkhwbkhumaelatngnoybaykhxngrth phuihenginthun xngkhkrsatharnsukh aelarthbal ihrwmmuxknephuxihsamarthphlitwkhsinthimiprasiththiphlidodymiprimanephiyngphxinkaraeckcahnayihaekekhttang thnghmdkhxngolkodyechphaaekhtthiyakcn 31 emuxwiekhraahprawtikhxngxutsahkrrmphthnawkhsinkphbwa karphthnacalmehlwinxtrarxyla 84 90 31 89 xnung ephraaokhwidepniwrsihm milksnatang thiyngimchdecnthnghmd aelatxngichklyuththaelaethkhonolyiihm ephuxphthnawkhsin thuk khntxncungesiyngimsaercsungmak 31 ephuxpraeminprasiththiphlthiwkhsinhnung xacmi kcatxngphthnaaebbcalxngthangkhxmphiwetxraelastwcalxngsungechphaaecaacngtxokhwidthiimekhymimakxn aelasingcalxngehlanikyngimsamarththdsxbyunynkblksnatang khxngiwrsthiyngimprakt epnsingthitxngrwmknthaodykalngcdtnginpi 2020 31 inbrrdawkhsinaekhndiedtthiyunynaelwwakalngphthna bristhexkchnepnphuphthnainxtrarxyla 70 thiehluxnkwichakar rthbal aelaxngkhkrsatharnsukhepnphuphthna 38 phuphthnawkhsinodymakepnbristhelk hruxthimnkwicyinmhawithyalyphumiprasbkarnnxyinkarxxkaebbwkhsinihprasbkhwamsaerc mithuncakdephuxthanganthdlxngthangkhlinikthisbsxnaelaephuxphlitwkhsinthaimidbristhephschphnthyksihykhamchatiepnhunswn 38 31 phukalngphthnawkhsinrwmxngkhkrinshrthaelaaekhnadasungthngsxngrwmknminganwicywkhsinthikalngdaeninkarepnxtrarxyla 46 thnghmdkhxngolk ethiybkbexechiythirxyla 36 rwmthngpraethscin aelakbyuorpthirxyla 18 31 karthdlxngraya 1 thiwangaephninpi 2020 aekikh wkhsinaekhndiedtthikalngxxkaebbhruxphthnainrayaphrikhliniksahrbokhwidxacimidrbxnumtiihsuksainmnusychwngpi 2020 ephraaepnphis immiprasiththiphlchknaihphumikhumkntxbsnxng hruxlmehlwindantang instwthdlxng hruxxacimmithunphx 292 293 sahrborkhtidechux oxkasprasbkhwamsaerckhxngwkhsinaekhndiedtinkarfaxupsrrkhrayaphrikhlinikaelwekhasukarthdlxnginmnusyrayathi 1 xyuinxtrarxyla 41 57 292 khaichcaykhxngkarthdlxngebuxngtninmnusykhxnkhangsungsahrbphuphthnawkhsin praeminxyuthi 14 25 landxllarshrth praman 440 786 lanbath sahrbopraekrmkarthdlxngrayathi 1 thwip aetkxacthung 70 landxllarshrth praman 2 200 lanbath idehmuxnkn 292 294 emuxepriybethiybkborkhiwrsxiobla thirabadthwrahwangpi 2013 2016 sungmiwkhsinaekhndiedt 37 chnid thiphthnaxyangerngdwn miephiyngchnidediywethannthiidrbxnumtiihichepnwkhsin odymikhaichcayephuxyunynprasiththiphlinkarthdlxngrayathi 2 3 pramanphnlandxllarshrth 35 292 lanbath 292 wkhsinthiimechphaaecaacngorkhokhwid aekikh wkhsinbangchnidmiphlthiimechphaaecaacng non specific effects khuxxacmipraoychnekinnxkehnuxcakorkhthipxngkn 295 aemxangwa mi kh mi y aela k kh xtrakartayehtuokhwidcatakwainpraethsthichidwkhsinbisiciephuxpxngknwnorkhepnpkti 296 297 298 299 aetxngkhkarxnamyolkkklawineduxnemsaynwa immihlkthanwawkhsinnimiphltanokhwid 300 ineduxnminakhm 2020 praethsenethxraelndiderimkarthdlxngwkhsinbisiciaebbsumephuxldkartidorkhokhwidodyrbaephthyphyabal 1 000 khn 301 xxsetreliykthdlxngaebbsumechnknodyrbaephthyphyabal 4 170 khn 302 303 karthdlxngaebbsumaelamiklumkhwbkhumodyyahlxkephuxtrwcwawkhsinexmexmxar pxngknorkhhd khangthum hdeyxrmn samarthpxngknaephthyphyabalcakorkhokhwidcaerimineduxnphvsphakhm 2020 thikrungikhorodyrbxasasmkhr 200 khn 304 wkhsinbisici aekikh nkwicyidsuksawkhsinbisicixnxacmiphlthiimechphaaecaacng non specific effects epnkarpxngknkartidechuxiwrsokhwid 19 hlngcaksngektkarnwaxtratayaelakhwamrunaerngkhxngorkhcanxykwainpraethskalngphthna thimkichwkhsinni aetxngkhkarxnamyolkketuxnwa mipccyhlayxyangthixacmiphltxkhxsngektechnniechn xtrakartrwcorkhokhwidaelapharaorkh disease burden 305 inkarthdlxngaebbsumaelamiklumkhwbkhum wkhsinniphbwamiphlimechphaaecaacngepnkarpxngknkartidechuxthanglmhayicxun 306 pccubn yngimmihlkthanphxsnbsnunkhxsrupwa wkhsinbisicimiprasiththiphaphpxngknokhwid 307 ineduxntulakhm mhawithyalyexksietxr xngkvs prakaskarthdlxngnanachatikhnadihyephuxsuksawa karihwkhsinbisicisamarthldxntraykhxngokhwidtxbukhlakrthangaephthyhruxim 308 309 sungenethxraelndkprakasechnediywknineduxnphvsphakhmkxnhnann 306 karichtwesrim adjuvant aekikh cnthungeduxnknyayn 2020 wkhsinaekhndiedt 11 xyangthixyuinrayakarthdlxngthangkhlinikichtwesrimephuxephimkartxbsnxngkhxngphumikhumkn 38 twesrim hrux immunological adjuvant epnsarthieluxkichkbwkhsinephuxephimkartxbsnxngkhxngphumikhumkntxaexntiecn echntxiwrsokhwidhruxikhhwdihy 310 trng kkhux twesrimxacichkbwkhsinokhwidephuxephimkartxbsnxngkhxngphumikhumknaelaephimprasiththiskyinkarldhruxpxngknkartidechuxokhwidinbukhkhlthiidwkhsin 310 311 twesrimxacmiprasiththiphaphepnphiessinethkhonolyithiichiwrsokhwidechuxtay inactivated inwkhsinoprtinthiidcakyinlukphsm recombinant protein hruxinwkhsinthiichewketxr vector 311 ekluxxalumieniym aluminum salt alum epntwesrimaerkthiichinwkhsinsungidxnumti odyeluxkisinwkhsinthiichtwesrimekinrxyla 80 311 aelaidichmatngaetkhristthswrrs 1920 epnsarthierimklikthangomelkulaelaesllxyanghlayhlakephuxephimkartxbsnxngkhxngphumikhumkn rwmthngkarplxyisotikhnthiesrimkarxkesb 310 311 khxcakdaelapyhathixacekid aekikhkarriberngphthnaaelaphlitwkhsinephuxokhwid 19 thirabadthwxacephimkhwamesiyngaelaxtrakhwamlmehlwkhxngkaridwkhsinthiplxdphyaelamiprasiththiphl 92 31 312 ngansuksahnungphbwainrahwangpi 2006 2015 sahrbwkhsin karidrbxnumtiihthakarthdlxngrayathi 1 aelwphankarthdlxngrayathi 3 xyangsaercxyuthixtrarxyla 16 2 89 aelaesphikidrabuwaxtraprasbkhwamsaerckhxngwkhsinaekhndiedtthikalngphthnaxyuinpi 2020 nacaxyuthiephiyngrxyla 10 31 ineduxnemsayn 2020 rayngankhxngesphirabuwa karprasannganaelakarrwmmuxknxyangekhmaekhngaelaepnsaklrahwangphuphthnawkhsin xngkhkrkhwbkhum xngkhkrtngnoybay phuihenginthun xngkhkrsatharnsukh aelarthbalepneruxngcaepnephuxihwkhsinaekhndiedtinrayasudthay samarthphlitidxyangephiyngphxaelaaeckcahnayihaekekhttidorkhthnghmdidxyangyutithrrm odyechphaaaekekhtthiyakcn 31 aetprachakrxacthungrxyla 10 krusukwawkhsinimplxdphyhruximcaepn aelaimyxmrbwkhsin sungepnxntraytxsatharnsukhkhxngolkthiidchuxwa vaccine hesitancy khwamlngelkbwkhsin 313 aelaephimkhwamesiyngwaokhwidcaekidrabadxik 314 inklangpi 2020 ngansarwcsxngnganpraeminwaprachakrshrthrxyla 67 hrux 80 cayxmrbkarchidwkhsinpxngknokhwid odymikhwamtang knmakehturadbkarsuksa karmingantha echuxchati aelaphumilaena 315 316 pyhakhwamplxdphythangchiwphaph aekikh nganwicyebuxngtnephuxpraeminprasiththiphlkhxngwkhsinodyichstwaebbcalxngthiechphaatxorkhokhwid echn hnuephaaihmiyinhnwyrb ACE aelaichstwthdlxngxun aelaiphremtthiimichmnusy aesdngwatxngrksakhwamplxdphythangchiwphaphinradb 3 emuxthdlxngiwrsthiyngimtay aelatxngrwmmuxkninradbsaklephuxihmimatrthanrksakhwamplxdphy 92 31 karephimvththikhxngechuxodyxasyphumitanthan ADE aekikh dubthkhwamhlkthi karephimvththikhxngechuxodyxasyphumitanthan aemwkhsincamungchwykratunihrangkayphlitsarphumitanthanephuxkacdechuxorkh aetwkhsinkxacmiphltrngknkhamodyephimvththikhxngechux epnkrabwnkarthieriykwa karephimvththikhxngechuxodyxasyphumitanthan antibody dependent enhancement ADE sungephimsmrrthphaphkhxngiwrsinkarcbkbesllepahmayinrangkayaelwcudchnwnxakarphayuisotikhnemuxtidechuxhlngcakidwkhsin 92 317 aephltfxrmethkhonolyikhxngwkhsin echn ichiwrsepnewketxr ichoprtin spike khxngiwrs hruxichhnwyyxyoprtinkhxngiwrs khnadwkhsinthiih rayaewlarahwangkarihwkhsinsa ephraaoxkaskartidechuxokhwidxik aelaxayumak lwnepnpccythikahndkhwamesiyngaelakhwamrunaerngkhxng ADE 92 317 kartxbsnxngkhxngphumikhumkntxwkhsinkyngkhunxyukbethkhonolyithiich rwmthngkhwamaemnyakhxngklikkarthangankhxngwkhsin 92 hruxwithikarih chidinklamenux chiditphiwhnng ihthangpak ihthangcmuk epntn 317 318 prasiththisky efficacy aekikh dubthkhwamhlkthi prasiththiskykhxngwkhsin prasiththiphaph effectiveness khxngwkhsinkhunxyukbprasiththisky efficacy khxngwkhsin 319 prasiththiskythinxykwarxyla 60 kxacimkxphumikhumknhmu 29 318 pccyswnbukhkhlthithaihesiyngtidorkh echn yin sukhphaph orkhpracatw xahar kartngkhrrph iwhruxaephxairngay phumikhumkn xayu thanathangesrsthkic hruxwthnthrrm xacepnpccypthmphumihruxthutiyphumisungmiphltxkhwamrunaerngemuxtidorkhaelakartxbsnxngtxwkhsin 318 khnchra xayuekin 60 pi phumiphumiaeph aelakhnxwnesiyngmikartxbsnxngkhxngphumikhumknthixxnaexaelwthaihwkhsinimmiprasiththiphl cungxactxngichethkhonolyiwkhsinodyechphaa sahrbkhnklumechphaa hruxtxngihwkhsinsa ephuxcakdkaraephrechux 318 xnung karklayphnthukhxngechuxiwrsxacepliynokhrngsrangthiepnepahmaykhxngwkhsin thaihwkhsinimidphl 320 321 karrbsmkhrxasasmkhrephuxthdlxng aekikh phuphthnawkhsintxnglngthunaekhngkhninradbnanachatiephuxhaxasasmkhrsahrbkarthdlxngthangkhlinikraya 2 3 ihmicanwnephiyngphxephraaiwrsrabadipinxtratang knthngkhampraethsaelainpraeths 118 yktwxyangechn ineduxnmithunayn bristhphlitwkhsincinkhuxsionaewkiboxethkidrwmmuxkbmaelesiy aekhnada shrachxanackr aelabrasilephuxrbxasasmkhrinkarthdlxngaelaephuxphlitwkhsinihidcanwnephiyngphxsahrbkarthdlxngrayathi 3 inpraethsbrasilthiorkhiderngrabadephimkhun 118 ephraacinkhwbkhumkarrabadthwkhxngokhwidid phuphthnawkhsincincungtxngrwmmuxkbnanachatiephuxthangansuksainmnusyrayaplay sungepnkaraekhngkhnhaxasasmkhrsukbphuphlitxun aelakbopraekrm Solidarity trial thixngkhkarxnamyolkepnphucd 118 nxkcakpyhakaraekhngkhnhaxasasmkhraelw phucdthakarthdlxngxacecxkbkhnthiimtxngkaridwkhsinephraaehtuphlekiywkbkhwamplxdphyaelaprasiththiskythikhankbkhwamehnphxngkhxngnkwithyasastr 314 hruximechuxinwithyasastrthiichephuxsrangethkhonolyiwkhsinaelasmrrthphaphkarpxngknkartidechuxkhxngwkhsin 322 karmibukhlakrthichanayinkarihwkhsinimphxxacepnxupsrrkhtxkarthdlxngthangkhlinikthitxngaekpyhatang echn karrbsmkhrxasasmkhrinekhtchnbththimikhwamhnaaennprachakrnxy xasasmkhrthimixayu echuxchati aelapyhathangsukhphaphtang 118 323 khaichcay aekikh wkhsintanokhwidthimiprasiththiphlxacldkhwamesiyhaythangesrsthkickhxngolkepnlanlandxllarshrth aeladngnn khaichcayepnphn landxllarshrth sahrbwkhsinemuxethiybknaelwkelknxy 324 intxntn khxngehtukarnrabadthw yngimchdecnwacasamarthsrangwkhsinsahrbiwrsniidxyangplxdphy echuxthuxid aelamirakhathiphxsuxihw aelakyngimrudwywacamikhaichcayephuxphthnawkhsinethair 29 32 56 epnipidwakarlngthunepnepnphn landxllarshrth nnxacimidphlxair 55 hlngcaksrangwkhsinidaelw catxngphlitwkhsinepnphn lanods aelwaeckcaythwolk ineduxnemsayn 2020 mulnithibilaelaemlindaektspraeminwa karphlitaelakaraeckcahnaywkhsinxacmikhaichcaythung 25 000 landxllarshrth pramanaepdaesnlanbath 325 khnakrrmathikaryuorpcdihmikarprachumthangwidioxkhxngphunaolkinwnthi 4 phvsphakhm 2020 sungidsyyawacaihengin 8 000 landxllarshrth ephuxphthnawkhsiniwrsokhorna epnnganediywkbkhxngxngkhkarxnamyolk 326 cnthungeduxnphvscikayn 2020 brisththiidenginthuncakopraekrmptibtikarkhwamerwehnuxaesngkhxngshrthidtngrakhawkhsinebuxngtnpraman 19 5 25 dxllarshrth praman 610 780 bath txods khnhnungpktitxngich 2 ods sungepnrakhapramanetha kbwkhsinikhhwdihy 327 ineduxnthnwakhm 2020 nkkaremuxngebleyiymphuhnungidepidephyrakhathishphaphyuorptklngsuxwkhsincakbristhtang 328 rakhawkhsinthishphaphyuorptklngsuxcakphuphlit phuphlit rakhatxods 329 bathodypramanaexstraesenka 1 78 62cxhnsnaexndcxhnsn US 8 50 266saonfi aeklkossmithikhln 7 56 265ifesxr ibxxnethkh 12 00 420Curevac 10 00 350omedxrna US 18 00 564karaeckcahnay aekikh wkhsintang txngkhnsngaelacdkartang kn twxyangechn wkhsin tozinameran khxngbristhifesxr ibxxnethkhtxngsngintuaechaekhngphiessodymixunhphumirahwang 80 thung 60 xngsaeslesiys 330 txngichin 5 wnhlnglalay 330 txngsngxyangnxy 975 ods cungkhngmiaet rph ihy sungmiekhruxngimekhruxngmuxdithisamarthihwkhsinniid 331 swnwkhsinkhxngomedxrnatxngekbaechaekhngrahwang 25 thung 15 xngsaeslesiys 332 aetemuxaechaekhngaelw ksamarthekbthixunhphumirahwang 2 thung 8 xngsaeslesiys cnthung 30 wn 332 karirkhxmulthiepidephyaelakhwamimechuxic aekikh shrthxahrbexmiertsidprakasihxnumtiwkhsinkhxngcinkhux BBIBP CorV aetkimidprakxbdwykhxmulaelaraylaexiydsakhytang 333 imehmuxnkbwkhsinthiphthnainpraethstawntkbangpraeths wkhsincinmikhxmulekiywkbkhwamplxdphyaelaprasiththiskynxy aemshrthxahrbexmiertscarabuwa idphicarnanganwiekhraahinrahwangkhxngbristh aetkimchdecnwa idwiekhraahkhxmuldibexngxyangepnxisra aelakimchdecnwa bristhidsrupkhxmulxyangir ephraashrthxahrbexmiertsimidraburaylaexiydkarwiekhraahthisakhy echn canwnkhntidechuxaelaxayukhxngxasasmkhr 333 nkwithyakarrabadchawcinthimhawithyalyxxksfxrdklawwa yakthicaruwawkhsinidphldikhnadihn phmhwngwamnkhngepncring 334 karimthakhxmulihepnsatharnaxaccakdbristhcakkaraeckcahnaywkhsinipyngpraethsbangpraeths ephraaimmnicinkhwamplxdphyaelaprasiththiskykhxngwkhsin nkwithyakarkhnediywknrabuwa karonmnawihpraethsxun khlxytamcatxngmihlkthanthangwithyasastrthiaennaelakhxmulthidisungsamarthihtrwcduid swnnkwithyaiwrsthimhawithyalyhxngkngxikkhnhnungepnhwngwa praethstang xactxngeluxkyxmrbwkhsinodyimmikarwiekhraahthiepnxisra hruxeluxkimichwkhsinniely 334 wkhsincinxikxyangkhux CoronaVac kmipyhaechnediywkn inwnthi 14 thnwakhm 2020 sankngankhwbkhumsatharnsukhbrasil Anvisa rabuwa karihxnumtiephuxichinpraethscinimicheruxngepidephy khuximmikhxmulwaichkdeknthxairinkarxnumtiihichepnkarchukechininpraethscinemuxeduxnmithunayn 2020 335 sahrbbthkhwamhlkinhmwdhmuni duthi okhornaaewk khwamoprngispyhakhxngkarsuksaaebb thathay thiesnx aekikhdubthkhwamhlkthi karthdlxngodynaechuxekhasumnusy ephraaorkhokhwidthikalngrabadthwepneruxngchukechinthwolk cungtxngphicarnayuththkaryxewlaephuxxnumtiihichwkhsinpxngknokhwid odyechphaakaryxewlakhxngkarthdlxngthangkhlinikraya 2 3 thipktiyawepnpi 336 337 338 ngansuksaaebb thathay epnkarthdlxngwkhsinodycngicthaihxasasmkhrtidechux epnwithithiekhythakborkhthiesiyngtaynxykwaokhwid echn ikhhwdihythwip ikhraksadnxy xhiwatkorkh aelamalaeriy 337 khuxemuxidtrwcsxbkhwamplxdphyaelaprasiththiphlkhxngwkhsinaekhndiedtinstwthdlxngaelamnusythisukhphaphpktiaelw xactxngthathay challenge cngicihxasasmkhrtidechuxokhwid odymiklumkhwbkhumaelakhamnganthdlxngraya 3 sungpktitxngtha ephuxchwyerngihxnumtiichwkhsinephuxpxngknorkhidxyangkwangkhwang 336 339 337 erimtngaeteduxnmkrakhm 2021 xasasmkhrphuihyhnumsawepnohl cacngicthaihtidechuxokhwidinkarthdlxngaebbthathayin rph inkrunglxndxnsungbriharodyhnwybriharwkhsinokhwidechphaakickhxngrthbalxngkvs 340 odyhlngcakkahndkhnadiwrsthithaihtidechuxid kcatrwcsxbprasiththiphaphpxngknkartidechuxkhxngwkhsinaekhndiedtsahrbokhwid 2 xyanghruxmakkwann 340 ngansuksaaebbthathaymisxngkhntxn khnaerktrwcsxbwkhsinaekhndiedtwaplxdphyhruximaelamiphltxphumitanthanxyangirthnginstwthdlxngaelaphuihyxasasmkhrsukhphaphdi 100 khn hruxnxykwann odythaphrxm knsungpkticathaepnladbtxknerimcakstwkxn emuxkhnaerkidphldi khnsxngepnkarthdlxngkhnadihyraya 2 3 aelaihwkhsinkhnadthiidphlaekxasasmkhrphuimidtidorkhmakxn mikhwamesiyngnxy echn phumixayunxy odycngicthaihtidechuxiwrsokhwidephuxepriybethiybkbklumkhwbkhumthiihyahlxk 336 337 339 hlngcak thathay ihtidorkhechnni kcaefatrwcxasasmkhrxyangiklchidinkhlinikthimixupkrnwsduphrxmmuxaelasamarthchwychiwitidthacaepn 336 337 karxasaepnphurwmngansuksaaebbthathayinchwngekidorkhrabadthwechnni khlaykbkarekhaptibtikarinehtukarnchukechinkhxngaephthyphyabalephuxrksakhnikhorkhokhwid hruxkhxngecahnathidbephling hruxkhxngphubricakhxwywa 336 aemngansuksaechnnicanasngsythangcriythrrmephraaxntraythixacekidkhuntxxasasmkhrehtuorkhrunaerngkhunxasywkhsin ephraaimchdecnwawkhsinplxdphyinrayayawhruxim hruxephraapraednpyhaxun aettamphuechiywchayineruxngorkhtidtxbangthan 336 337 339 ngansuksaechnnikxaceliyngimidephuxihsamarthphlitwkhsinthimiphlidxyangrwderwaelachwyldcanwnkhntayehtuokhwidthikawaxactkepnlan khnthwolk 336 341 inwnthi 6 phvsphakhm 2020 xngkhkarxnamyolkidphthnaaenwptibtithiaesdngkdeknthkarsuksaokhwidaebbthathayinxasasmkhrsukhphaphdi rwmwithikarpraeminthangwithyasastraelathangcriythrrm karpruksaharuxaelakarprasanngankbprachachn kareluxkaelakarkhxkhayinyxmkhxngxasasmkhr aelakarduaelsxdsxngodyphuechiywchayxisra 342 karxnuyatihichepnkarchukechin EUA aekikhemuxokhwididerimrabadthwemuxtnpi 2020 xngkhkarxnamyolkidephyaephraenwthangkarcdbychiraykaryaihichepnkarchukechin Emergency Use Listing sahrbwkhsinihm epnkrabwnkarthiidmacakkarrabadthwkhxngxioblarahwangpi 2013 2016 343 sungbngkhbwa wkhsinaekhndiedtthiphthnaephuxkarchukechinxnepnxntraythungchiwittxngphanmatrthan GMP aelatxngphankarphthnatamkrabwnkarihxnuyatkxn prequalification khxngxngkhkar 343 aememuxmiwkhsinihm thiphthnakhuninrahwangkarrabadthwkhxngokhwid karihxnuyatkyngbngkhbihsngexksaraebbetmineruxngkarphthnaaelakhunphaphkarphlit ethiybkbshphaphyuorp thibristhsamarthichkrabwnkarphicarnaxyangtxenuxng rolling review khuxihkhxmultamethathiidinkarthdlxngrayathi 3 aethnthicasngkhxmuletmsungtxngthaepneduxn hruxpi hlngkarthdlxnginkrabwnkarpkti krabwnkarechnnithaihkhnakrrmkarewchphnthsahrbichinmnusyyuorp CHMP samarthpraeminkhxmulinewlacring sungchwyihwkhsinaekhndiedtxnmixnakhtsamarthidxnumtixyangrwderwcaksankngankaraephthyyuorp EMA 344 ineduxntulakhm krathrwngsatharnsukhaekhnadaaelasankngankaraephthyyuorpiderimkarphicarnaxyangtxenuxngsahrbwkhsinkhxngbristhomedxrna 345 aelainaekhnadaeduxnphvscikayn sahrbwkhsinkhxngbristhifesxr ibxxnethkh 346 wnthi 24 mithunayn 2020 praethscinidxnumtiwkhsinkhxngbristhaekhnsioniboxlxciksephuxihichxyangcakdinthhar aelaxnumtiwkhsinaebbiwrsokhwidkhaaelwsxngxyangephuxichinkarchukechinsahrbphuprakxbxachiphkhwamesiyngsung 347 inwnthi 11 singhakhm 2020 rsesiyprakaskarxnumtiwkhsinsputnik wi ephuxichinkarchukechin aeteduxnhnungtxcaknn kyngmiwkhsinephiyngcanwnnxythiaeckcahnaynxkkarthdlxngthangkhlinikrayathi 3 348 ineduxnknyayn shrthxahrbexmiertsxnumtiwkhsinkhxngbristhsionfarmepnkarchukechinsahrbbukhlakrthangaephthy 349 odybahernkthaechnediywknineduxnphvscikayntxma 350 inshrth xngkhkarxaharaelayaxacihxnumtiepnkarchukechinaekwkhsinokhwidkxncaidhlkthanetmcakkarthdlxngrayathi 3 ineruxngkhwamplxdphyaelaprasiththisky aetkthukwicarnwaichxyangphid ephraaehtuthangkaremuxng epnkarldmatrthan aelaephimkhwamrusuktxtanwkhsinkhxngprachachninchwngpi 2020 315 351 352 inwnthi 8 knyayn 2020 bristhyaaenwhna 9 brisththiwicywkhsinokhwidcungidrwmihsyyawa cayunkhakhxichepnkarchukechinktxemuxkarthdlxngrayathi 3 idrabuwkhsinwaplxdphyaelamiprasiththiskyaelw 353 wnthi 20 phvscikayn 2020 bristhifesxr ibxxnethkhidyunkhakhxichwkhsinkhxngbristhepnkarchukechinaekxngkhkarxaharaelayashrth 354 355 odyxngkhkarkprakaswa khnakrrmkarthipruksaeruxngwkhsinaelaphlitphnthchiwphaphthiekiywkhxng VRBPAC khxngxngkhkarcaphicarnakhakhxniinwnthi 10 thnwakhm 356 357 ineduxnphvscikayn xngkhkaridxthibaywa karxnuyatihichepnkarchukechinkkhux klikthixanwykarthaihmiaelakarichwithiaekpyhathangaephthyrwmthngwkhsin inchwngkhwamchukechinthangsatharnsukh echn karrabadthwkhxngokhwid 19 inpccubn 358 emuxxngkhkarxnumtiihichepnkarchukechinaelw phuphthnawkhsinkyngtxngdaeninkarthdlxngrayathi 3 txipephuxburnakarkhxmulkhwamplxdphyaelaprasiththiskykhxngwkhsin odyinthisudkcayunkhakhxxnumtiaebbetm 358 inwnthi 30 phvscikayn 2020 bristhomedxrnaidyunkhakhxichwkhsinepnkarchukechinaekxngkhkarxaharaelayashrth 359 360 bahern aekikh ineduxnphvscikaynaelathnwakhm 2020 xngkhkarkhwbkhumthangsukhphaphaehngchatibahern National Health Regulatory Authority NHRA idxnuyatihichwkhsin BBIBP CorV khxngbristhsionfarm aelawkhsin tozinameran khxngbristhifesxr ibxxnethkhepnkarchukechin 94 aekhnada aekikh inwnthi 9 thnwakhm 2020 krathrwngsatharnsukhaekhnada Health Canada idxnuyatihnaekhawkhsinkhxngbristhifesxr ibxxnethkhephuxichinkarchukechinxyangchwkhraw 96 miwkhsin 30 000 odssngmathungaekhnadainwnthi 13 thnwakhm odykawacaid 249 000 odsimekinplaypi 2020 aela 6 lanods kxneduxnemsayn 2021 361 emksiok aekikh inwnthi 11 thnwakhm 2020 khnakrrmkarklangpxngknkhwamesiyngthangxnamy Federal Commission for the Protection against Sanitary Risk COFEPRIS khxngemksiokidxnuyatihichwkhsinkhxngbristhifesxr ibxxnethkhepnkarchukechin wkhsinidsngaelw 34 4 lanods odyerimsngtngaetklangeduxnthnwakhm 99 filippins aekikh inwnthi 2 thnwakhm 2020 prathanathibdifilippinsordriok duaetret idsngxngkhkrxaharae, wikipedia, วิกิ หนังสือ,

หนังสือ

, ห้องสมุด,

บทความ

, อ่าน, ดาวน์โหลด, ฟรี, ดาวน์โหลดฟรี, mp3, วิดีโอ, mp4, 3gp, jpg, jpeg, gif, png, รูปภาพ, เพลง, เพลง, หนัง, หนังสือ, เกม, เกม
ติดต่อเรา